KEGG   Homo sapiens (human): 8504Help
Entry
8504              CDS       T01001                                 

Gene name
PEX3, PBD10A, TRG18
Definition
(RefSeq) peroxisomal biogenesis factor 3
  KO
K13336  
peroxin-3
Organism
hsa  Homo sapiens (human)
Pathway
Peroxisome
Disease
H00205  
Peroxisome biogenesis disorder
H01342  
Zellweger syndrome (ZS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    8504 (PEX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q24.2
AA seq 373 aa AA seqDB search
MLRSVWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAAEYIAQARRQYHFES
NQRTCNMTVLSMLPTLREALMQQLNSESLTALLKNRPSNKLEIWEDLKIISFTRSTVAVY
STCMLVVLLRVQLNIIGGYIYLDNAAVGKNGTTILAPPDVQQQYLSSIQHLLGDGLTELI
TVIKQAVQKVLGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMP
DEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFR
PTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAAN
VYEAFSTPQQLEK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggtctgtatggaattttctgaaacgccacaaaaagaaatgcatcttcctgggc
acggtccttggaggagtatatattctggggaaatatggacagaagaaaatcagagaaata
caggaaagggaggctgcagaatacattgcccaagcacgacgacaatatcattttgaaagt
aaccagaggacttgcaatatgacagtgctgtccatgcttccaacactgagagaggcctta
atgcagcaactgaattccgagagcctcacagctctgctaaaaaacaggccttcaaacaag
ctagaaatatgggaggatctgaagataataagtttcacaagaagtactgtggctgtatac
agtacctgtatgctggttgttcttttgcgggtccagttaaacataattggtggatatatt
tacctggataatgcagcagttggcaaaaatggcactacaattcttgctcccccagatgtc
caacagcagtatttatcaagtattcagcacctacttggagatggcctgacagaattgatc
actgtcattaaacaagctgtgcagaaggttttaggaagtgtttctcttaaacattctttg
tcccttttggacttggagcaaaaactaaaagaaatcagaaatctcgttgagcagcataag
tcttcttcttggattaataaagatggatccaaacctttattatgccattatatgatgcca
gatgaagaaactccattagcagtgcaggcctgtggactttctcctcgagacattaccact
attaaacttctcaatgaaactagagacatgttggaaagcccagattttagtacagttttg
aatacctgtttaaaccgaggttttagtagacttctagacaatatggctgagttctttcga
cctactgaacaggacctgcaacatggtaactctatgaatagtctttccagtgtcagcctg
cctttagctaagataattccaatagtaaacggacagatccattcagtttgcagtgaaaca
cctagtcattttgttcaggatctgttgacaatggagcaagtgaaagactttgctgctaat
gtgtatgaagcttttagtacccctcagcaactggagaaatga

DBGET integrated database retrieval system