KEGG   Homo sapiens (human): 8517Help
Entry
8517              CDS       T01001                                 

Gene name
IKBKG, AMCBX1, FIP-3, FIP3, Fip3p, IKK-gamma, IP, IP1, IP2, IPD2, NEMO, ZC2HC9
Definition
inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma
Orthology
K07210  
inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Hepatitis C
Hepatitis B
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Primary immunodeficiency
Disease
H00095  
Ectodermal dysplasia associated immunodeficiency (EDA-ID)
H00540  
Osteoporosis, lymphedema, anhydrotic ectodermal dysplasia with immunodeficiency (OLEDAID)
H00645  
Incontinentia pigmenti
H01245  
Immunodeficiency without anhidrotic ectodermal  dysplasia
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:hsa04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:hsa04623]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:hsa04662]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Cancers; Pancreatic cancer [PATH:hsa05212]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:hsa05221]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:hsa05220]
Human Diseases; Cancers; Prostate cancer [PATH:hsa05215]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Immune diseases; Primary immunodeficiency [PATH:hsa05340]
Human Diseases; Infectious diseases; Epithelial cell signaling in Helicobacter pylori infection [PATH:hsa05120]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq28
AA seq 487 aa AA seqDB search
MALVIQVGKLRPREVRTPQTINPSLFPSLPVKLSSIIEVPSGGERCCSRRTLVYKARAFW
KGAPLPCWMNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQ
RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL
DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG
RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV
AYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHK
IVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR
IEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQI
HVMECIE
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcccttgtgatccaggtggggaaactaaggcccagagaagtgaggaccccgcagact
atcaatcccagtctcttcccctcactccctgtgaagctctccagcatcatcgaggtccca
tcaggtggggaaagatgctgttccaggcgcacactagtctacaaggccagagctttctgg
aagggggcacccttgccctgttggatgaataggcacctctggaagagccaactgtgtgag
atggtgcagcccagtggtggcccggcagcagatcaggacgtactgggcgaagagtctcct
ctggggaagccagccatgctgcacctgccttcagaacagggcgctcctgagaccctccag
cgctgcctggaggagaatcaagagctccgagatgccatccggcagagcaaccagattctg
cgggagcgctgcgaggagcttctgcatttccaagccagccagagggaggagaaggagttc
ctcatgtgcaagttccaggaggccaggaaactggtggagagactcggcctggagaagctc
gatctgaagaggcagaaggagcaggctctgcgggaggtggagcacctgaagagatgccag
cagcagatggctgaggacaaggcctctgtgaaagcccaggtgacgtccttgctcggggag
ctgcaggagagccagagtcgcttggaggctgccactaaggaatgccaggctctggagggt
cgggcccgggcggccagcgagcaggcgcggcagctggagagtgagcgcgaggcgctgcag
cagcagcacagcgtgcaggtggaccagctgcgcatgcagggccagagcgtggaggccgcg
ctccgcatggagcgccaggccgcctcggaggagaagaggaagctggcccagttgcaggtg
gcctatcaccagctcttccaagaatacgacaaccacatcaagagcagcgtggtgggcagt
gagcggaagcgaggaatgcagctggaagatctcaaacagcagctccagcaggccgaggag
gccctggtggccaaacaggaggtgatcgataagctgaaggaggaggccgagcagcacaag
attgtgatggagaccgttccggtgctgaaggcccaggcggatatctacaaggcggacttc
caggctgagaggcaggcccgggagaagctggccgagaagaaggagctcctgcaggagcag
ctggagcagctgcagagggagtacagcaaactgaaggccagctgtcaggagtcggccagg
atcgaggacatgaggaagcggcatgtcgaggtctcccaggcccccttgccccccgcccct
gcctacctctcctctcccctggccctgcccagccagaggaggagcccccccgaggagcca
cctgacttctgctgtcccaagtgccagtatcaggcccctgatatggacaccctgcagata
catgtcatggagtgcattgagtag

DBGET integrated database retrieval system