KEGG   Homo sapiens (human): 8519Help
Entry
8519              CDS       T01001                                 

Gene name
IFITM1, 9-27, CD225, DSPA2a, IFI17, LEU13
Definition
interferon induced transmembrane protein 1
Orthology
K06566  
interferon induced transmembrane protein
Organism
hsa  Homo sapiens (human)
Pathway
B cell receptor signaling pathway
Class
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:hsa04662]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.5
AA seq 125 aa AA seqDB search
MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYS
VKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQ
EKRGY
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaggaggaacatgaggtggctgtgctgggggcaccccccagcaccatccttcca
aggtccaccgtgatcaacatccacagcgagacctccgtgcccgaccatgtcgtctggtcc
ctgttcaacaccctcttcttgaactggtgctgtctgggcttcatagcattcgcctactcc
gtgaagtctagggacaggaagatggttggcgacgtgaccggggcccaggcctatgcctcc
accgccaagtgcctgaacatctgggccctgattctgggcatcctcatgaccattggattc
atcctgttactggtattcggctctgtgacagtctaccatattatgttacagataatacag
gaaaaacggggttactag

DBGET integrated database retrieval system