KEGG   Homo sapiens (human): 8519Help
Entry
8519              CDS       T01001                                 

Gene name
IFITM1, 9-27, CD225, DSPA2a, IFI17, LEU13
Definition
interferon induced transmembrane protein 1
Orthology
K06566  
interferon induced transmembrane protein
Organism
hsa  Homo sapiens (human)
Pathway
B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04662 B cell receptor signaling pathway
    8519 (IFITM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   8519 (IFITM1)
Cellular antigens [BR:hsa04090]
 Proteins
  8519 (IFITM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.5
AA seq 125 aa AA seqDB search
MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYS
VKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQ
EKRGY
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaggaggaacatgaggtggctgtgctgggggcaccccccagcaccatccttcca
aggtccaccgtgatcaacatccacagcgagacctccgtgcccgaccatgtcgtctggtcc
ctgttcaacaccctcttcttgaactggtgctgtctgggcttcatagcattcgcctactcc
gtgaagtctagggacaggaagatggttggcgacgtgaccggggcccaggcctatgcctcc
accgccaagtgcctgaacatctgggccctgattctgggcatcctcatgaccattggattc
atcctgttactggtattcggctctgtgacagtctaccatattatgttacagataatacag
gaaaaacggggttactag

DBGET integrated database retrieval system