KEGG   Homo sapiens (human): 85235Help
Entry
85235             CDS       T01001                                 

Gene name
HIST1H2AH, H2A/S, H2AFALii, H2AH, dJ86C11.1
Definition
(RefSeq) histone cluster 1 H2A family member h
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    85235 (HIST1H2AH)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    85235 (HIST1H2AH)
  Substance dependence
   05034 Alcoholism
    85235 (HIST1H2AH)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    85235 (HIST1H2AH)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   85235 (HIST1H2AH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 85235
NCBI-ProteinID: NP_542163
OMIM: 615013
HGNC: 13671
Ensembl: ENSG00000274997
Vega: OTTHUMG00000014468
Pharos: Q96KK5(Tdark)
UniProt: Q96KK5 A3KPC7
Position
6p22.1
AA seq 128 aa AA seqDB search
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtctggacgtggcaagcaaggcggtaaagctcgcgccaaggccaagacccgctcttct
cgggctgggcttcagttccccgtgggccgagtgcaccgcctgctccgcaagggtaattat
gccgagcgggttggagccggcgcgccagtgtacctggctgcggtgctggagtacctgacc
gctgagatcctggagctggctggcaatgcggcccgcgacaacaagaagacccgtatcatc
ccgcgtcacctccaactggccatccgcaacgacgaggagctcaacaagctgctgggcaaa
gtcaccatcgcgcagggtggtgtcttgcccaatatccaggccgtgctgctgcctaagaag
actgagagccaccataaggccaaataa

DBGET integrated database retrieval system