KEGG   Homo sapiens (human): 8527Help
Entry
8527              CDS       T01001                                 

Gene name
DGKD, DGKdelta, dgkd-2
Definition
diacylglycerol kinase, delta 130kDa (EC:2.7.1.107)
Orthology
K00901  
diacylglycerol kinase (ATP dependent) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    8527 (DGKD)
   00564 Glycerophospholipid metabolism
    8527 (DGKD)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    8527 (DGKD)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     8527 (DGKD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q37.1
AA seq 1170 aa AA seqDB search
MNMFLYFQTIIKEGMLTKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVA
ESSTKNVNNSFTVITPCRKLILCADNRKEMEDWIAALKTVQNREHFEPTQYSMDHFSGMH
NWYACSHARPTYCNVCREALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKD
IIEDADGIAMPHQWLEGNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTSCKESLLT
KCPLGLCKVSVIPPTALNSIDSDGFWKASCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQ
LLNPAQVFDLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVL
PLGTGNDLARVLGWGSACDDDTQLPQILEKLERASTKMLDRWSVMAYEAKLPRQASSSTV
TEDFSEDSEVQQILFYEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEK
TTESSEESEVMAKKCSVLKEKLDSLLKTLDDESQASSSLPNPPPTIAEEAEDGDGSGSIC
GSTGDRLVASACPARPQIFRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQEQEGF
VLGLSESEEKMDHRVCPPLSHSESFGVPKGRSQRKVSKSPCEKLISKGSLSLGSSASLPP
QPGSRDGLPALNTKILYPNVRAGMSGSLPGGSVISRLLINADPFNSEPETLEYYTEKCVM
NNYFGIGLDAKISLDFNNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLE
CDGRPIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMA
VSRVIRLQHHRIAQCRTVKISILGDEGVPVQVDGEAWVQPPGYIRIVHKNRAQTLTRDRA
FESTLKSWEDKQKCELPRPPSCSLHPEMLSEEEATQMDQFGQAAGVLIHSIREIAQSHRD
MEQELAHAVNASSKSMDRVYGKPRTTEGLNCSFVLEMVNNFRALRSETELLLSGKMALQL
DPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFK
KEKNNKNKEAHSSLGAPVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRDL
KDLGVTKVGHMKRILCGIKELSRSAPAVEA
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtttctgtactttcagaccatcatcaaagaggggatgctgaccaaacagaac
aattcattccagcgatcaaaaaggagatactttaagcttcgagggcgaacgctttactat
gccaaaacggcaaagtcaatcatatttgatgaggtggatctgacagatgccagcgtagct
gaatccagtaccaaaaacgtcaacaacagttttacggtcataactccatgcaggaagctc
atcttgtgtgctgataacagaaaagaaatggaagattggattgcagcattaaagactgtg
cagaacagggagcactttgagcccacccagtacagcatggaccacttctcagggatgcac
aattggtacgcctgttcccacgcgaggccgacctactgcaatgtgtgccgtgaggctctg
tctggggtcacgtcgcacgggctgtcctgcgaggtgtgcaaatttaaggcccacaagcgc
tgtgctgtgcgtgcaaccaataactgcaagtggaccacactggcctcgatcgggaaggac
atcattgaagatgcagatgggattgcaatgccccaccagtggttggaaggaaacctacct
gtgagcgccaagtgcactgtgtgcgacaagacctgtggcagtgtgctgcgcctgcaggac
tggcgctgcctctggtgcaaggccatggttcacacatcgtgtaaagaatccttgctgacc
aagtgcccacttggcctgtgcaaagtgtcagtcatcccacccacggctctcaacagcatc
gactccgatgggttctggaaggccagctgtcctccttcttgcacaagcccactgttggtc
ttcgtcaattcaaaaagtggggacaaccagggtgtgaagttcctcagaagattcaaacag
ctactaaaccccgcccaggtcttcgacctcatgaacggaggcccacacctcggcttacgg
ttattccagaagtttgacacattccggattctggtttgtggcggggatggaagtgttggc
tgggtcctctccgaaatcgacagcctcaaccttcataaacagtgtcagctgggagtgctg
ccgctcggcacagggaacgacttggcccgagtactgggctggggctcagcctgcgatgac
gacacccagctcccccagatcttggagaagttggagagagccagcaccaagatgctggac
aggtggagcgtcatggcatacgaggccaagctcccccggcaggcctcctcctctaccgtc
accgaagacttcagcgaggattccgaggtacagcagattctcttctatgaagactcggtt
gcagcccacctttctaaaatcctcacctcggaccagcactcggtggtcatctcctcggcc
aaagtgctctgtgagacggtgaaggacttcgtggcacgggtggggaaggcctatgagaag
acgaccgagagctcggaggagtcagaggtcatggccaagaagtgctctgtcctgaaagag
aagctggattcccttctcaagaccttggacgatgagtcccaggcctcgtcctctctgccc
aacccgccccccaccattgccgaggaggctgaagatggagatgggtcgggcagcatctgc
ggttccaccggagaccgcttggtggcatcagcttgcccggcccggccgcagatattccgg
cctcgagaacagctcatgctgagagccaacagcctgaagaaagcaattcgtcagatcata
gaacacacagaaaaagctgtcgatgagcagaatgcccagacccaggagcaggagggcttc
gtcctgggcctctctgagtcagaggagaagatggaccacagagtgtgcccaccactgtcc
cacagcgagagcttcggggtccccaaggggaggagccagcgcaaagtgtcgaaatctccg
tgtgaaaagctgatcagcaaagggagtctgtccctaggcagttctgcttcccttccgccc
cagccgggaagccgggacggcctgcctgcgctcaacaccaagatcctgtacccaaatgtc
cgggctggaatgtctggttccttacccggtggctcagtcatcagtcgcctgttaattaat
gctgatcccttcaactctgaaccagaaaccctagagtattacacggagaaatgtgtcatg
aacaactattttggcattggcctggatgcgaagatatccctggactttaacaacaagcgc
gatgagcacccagagaagtgcaggagccgaaccaagaacatgatgtggtatggagttctt
ggaaccaaagagttgctgcacagaacctacaagaacctggagcaaaaggtcttgctggag
tgtgacgggcgacccatcccactccccagtcttcagggaattgctgtccttaacattccc
agctatgccggaggaaccaacttctgggggggtaccaaggaagatgatactttcgcagct
ccatcattcgatgacaagattctggaggtggtcgccgtgttcggcagcatgcagatggcc
gtctctcgagtcatcaggctacagcatcatcggatcgcccagtgtcgcacggtgaagatc
tccatccttggggatgagggcgtgcctgtgcaggtggacggagaggcctgggtccagccg
ccagggtacattcggattgtccacaagaaccgggcacagacactgaccagagacagggca
tttgagagcaccctgaagtcctgggaagacaagcagaagtgcgagctgccccgccctcca
tcctgttccctgcacccggagatgctgtccgaggaggaggccacccagatggaccagttt
gggcaggcagcaggggtcctcattcacagtatccgagaaatagctcagtctcaccgggac
atggagcaggaactggcccacgccgtcaatgccagctccaagtccatggaccgtgtgtat
ggcaagcccagaaccacagaggggctcaactgcagcttcgtcctggaaatggtgaataac
ttcagagctctgcgcagtgagacggagctgctgctgtctgggaagatggccctgcagctg
gatccgcctcagaaggagcagctggggagtgctcttgccgagatggaccgacagctcagg
aggctggcagacaccccgtggctctgccagtccgcagagcccggcgacgaagagagtgtg
atgctggatcttgccaagcgcagtcgcagtggtaaattccgcctcgtgaccaagtttaaa
aaggagaaaaacaacaagaacaaagaagctcacagtagcctgggagccccggttcacctc
tgggggacagaggaggttgctgcctggctggagcacctcagtctctgtgagtataaggac
atcttcacacggcacgacatccggggctctgagctcctgcacctggagcggagggacctc
aaggacctgggcgtgaccaaggtgggccacatgaagaggatcctgtgtggcatcaaggag
ctgagccgcagcgcccccgccgtcgaggcctag

DBGET integrated database retrieval system