KEGG   Homo sapiens (human): 8527Help
Entry
8527              CDS       T01001                                 

Gene name
DGKD, DGKdelta, dgkd-2
Definition
diacylglycerol kinase, delta 130kDa (EC:2.7.1.107)
Orthology
K00901  
diacylglycerol kinase (ATP dependent) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    8527 (DGKD)
   00564 Glycerophospholipid metabolism
    8527 (DGKD)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    8527 (DGKD)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    8527 (DGKD)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     8527 (DGKD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q37.1
AA seq 1170 aa AA seqDB search
MNMFLYFQTIIKEGMLTKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVA
ESSTKNVNNSFTVITPCRKLILCADNRKEMEDWIAALKTVQNREHFEPTQYSMDHFSGMH
NWYACSHARPTYCNVCREALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKD
IIEDADGIAMPHQWLEGNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTSCKESLLT
KCPLGLCKVSVIPPTALNSIDSDGFWKASCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQ
LLNPAQVFDLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVL
PLGTGNDLARVLGWGSACDDDTQLPQILEKLERASTKMLDRWSVMAYEAKLPRQASSSTV
TEDFSEDSEVQQILFYEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEK
TTESSEESEVMAKKCSVLKEKLDSLLKTLDDESQASSSLPNPPPTIAEEAEDGDGSGSIC
GSTGDRLVASACPARPQIFRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQEQEGF
VLGLSESEEKMDHRVCPPLSHSESFGVPKGRSQRKVSKSPCEKLISKGSLSLGSSASLPP
QPGSRDGLPALNTKILYPNVRAGMSGSLPGGSVISRLLINADPFNSEPETLEYYTEKCVM
NNYFGIGLDAKISLDFNNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLE
CDGRPIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMA
VSRVIRLQHHRIAQCRTVKISILGDEGVPVQVDGEAWVQPPGYIRIVHKNRAQTLTRDRA
FESTLKSWEDKQKCELPRPPSCSLHPEMLSEEEATQMDQFGQAAGVLIHSIREIAQSHRD
MEQELAHAVNASSKSMDRVYGKPRTTEGLNCSFVLEMVNNFRALRSETELLLSGKMALQL
DPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFK
KEKNNKNKEAHSSLGAPVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRDL
KDLGVTKVGHMKRILCGIKELSRSAPAVEA
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtttctgtactttcagaccatcatcaaagaggggatgctgaccaaacagaac
aattcattccagcgatcaaaaaggagatactttaagcttcgagggcgaacgctttactat
gccaaaacggcaaagtcaatcatatttgatgaggtggatctgacagatgccagcgtagct
gaatccagtaccaaaaacgtcaacaacagttttacggtcataactccatgcaggaagctc
atcttgtgtgctgataacagaaaagaaatggaagattggattgcagcattaaagactgtg
cagaacagggagcactttgagcccacccagtacagcatggaccacttctcagggatgcac
aattggtacgcctgttcccacgcgaggccgacctactgcaatgtgtgccgtgaggctctg
tctggggtcacgtcgcacgggctgtcctgcgaggtgtgcaaatttaaggcccacaagcgc
tgtgctgtgcgtgcaaccaataactgcaagtggaccacactggcctcgatcgggaaggac
atcattgaagatgcagatgggattgcaatgccccaccagtggttggaaggaaacctacct
gtgagcgccaagtgcactgtgtgcgacaagacctgtggcagtgtgctgcgcctgcaggac
tggcgctgcctctggtgcaaggccatggttcacacatcgtgtaaagaatccttgctgacc
aagtgcccacttggcctgtgcaaagtgtcagtcatcccacccacggctctcaacagcatc
gactccgatgggttctggaaggccagctgtcctccttcttgcacaagcccactgttggtc
ttcgtcaattcaaaaagtggggacaaccagggtgtgaagttcctcagaagattcaaacag
ctactaaaccccgcccaggtcttcgacctcatgaacggaggcccacacctcggcttacgg
ttattccagaagtttgacacattccggattctggtttgtggcggggatggaagtgttggc
tgggtcctctccgaaatcgacagcctcaaccttcataaacagtgtcagctgggagtgctg
ccgctcggcacagggaacgacttggcccgagtactgggctggggctcagcctgcgatgac
gacacccagctcccccagatcttggagaagttggagagagccagcaccaagatgctggac
aggtggagcgtcatggcatacgaggccaagctcccccggcaggcctcctcctctaccgtc
accgaagacttcagcgaggattccgaggtacagcagattctcttctatgaagactcggtt
gcagcccacctttctaaaatcctcacctcggaccagcactcggtggtcatctcctcggcc
aaagtgctctgtgagacggtgaaggacttcgtggcacgggtggggaaggcctatgagaag
acgaccgagagctcggaggagtcagaggtcatggccaagaagtgctctgtcctgaaagag
aagctggattcccttctcaagaccttggacgatgagtcccaggcctcgtcctctctgccc
aacccgccccccaccattgccgaggaggctgaagatggagatgggtcgggcagcatctgc
ggttccaccggagaccgcttggtggcatcagcttgcccggcccggccgcagatattccgg
cctcgagaacagctcatgctgagagccaacagcctgaagaaagcaattcgtcagatcata
gaacacacagaaaaagctgtcgatgagcagaatgcccagacccaggagcaggagggcttc
gtcctgggcctctctgagtcagaggagaagatggaccacagagtgtgcccaccactgtcc
cacagcgagagcttcggggtccccaaggggaggagccagcgcaaagtgtcgaaatctccg
tgtgaaaagctgatcagcaaagggagtctgtccctaggcagttctgcttcccttccgccc
cagccgggaagccgggacggcctgcctgcgctcaacaccaagatcctgtacccaaatgtc
cgggctggaatgtctggttccttacccggtggctcagtcatcagtcgcctgttaattaat
gctgatcccttcaactctgaaccagaaaccctagagtattacacggagaaatgtgtcatg
aacaactattttggcattggcctggatgcgaagatatccctggactttaacaacaagcgc
gatgagcacccagagaagtgcaggagccgaaccaagaacatgatgtggtatggagttctt
ggaaccaaagagttgctgcacagaacctacaagaacctggagcaaaaggtcttgctggag
tgtgacgggcgacccatcccactccccagtcttcagggaattgctgtccttaacattccc
agctatgccggaggaaccaacttctgggggggtaccaaggaagatgatactttcgcagct
ccatcattcgatgacaagattctggaggtggtcgccgtgttcggcagcatgcagatggcc
gtctctcgagtcatcaggctacagcatcatcggatcgcccagtgtcgcacggtgaagatc
tccatccttggggatgagggcgtgcctgtgcaggtggacggagaggcctgggtccagccg
ccagggtacattcggattgtccacaagaaccgggcacagacactgaccagagacagggca
tttgagagcaccctgaagtcctgggaagacaagcagaagtgcgagctgccccgccctcca
tcctgttccctgcacccggagatgctgtccgaggaggaggccacccagatggaccagttt
gggcaggcagcaggggtcctcattcacagtatccgagaaatagctcagtctcaccgggac
atggagcaggaactggcccacgccgtcaatgccagctccaagtccatggaccgtgtgtat
ggcaagcccagaaccacagaggggctcaactgcagcttcgtcctggaaatggtgaataac
ttcagagctctgcgcagtgagacggagctgctgctgtctgggaagatggccctgcagctg
gatccgcctcagaaggagcagctggggagtgctcttgccgagatggaccgacagctcagg
aggctggcagacaccccgtggctctgccagtccgcagagcccggcgacgaagagagtgtg
atgctggatcttgccaagcgcagtcgcagtggtaaattccgcctcgtgaccaagtttaaa
aaggagaaaaacaacaagaacaaagaagctcacagtagcctgggagccccggttcacctc
tgggggacagaggaggttgctgcctggctggagcacctcagtctctgtgagtataaggac
atcttcacacggcacgacatccggggctctgagctcctgcacctggagcggagggacctc
aaggacctgggcgtgaccaaggtgggccacatgaagaggatcctgtgtggcatcaaggag
ctgagccgcagcgcccccgccgtcgaggcctag

DBGET integrated database retrieval system