KEGG   Homo sapiens (human): 85417Help
Entry
85417             CDS       T01001                                 

Gene name
CCNB3
Definition
cyclin B3
Orthology
K05868  
cyclin B
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Cell cycle
p53 signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    85417 (CCNB3)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    85417 (CCNB3)
   04115 p53 signaling pathway
    85417 (CCNB3)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    85417 (CCNB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp11
AA seq 1395 aa AA seqDB search
MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESPSSLQGALKKR
SAFEDLTNASQCQPVQPKKEANKEFVKVVSKKINRNTHALGLAKKNKRNLKWHKLEVTPV
VASTTVVPNIMEKPLILDISTTSKTPNTEEASLFRKPLVLKEEPTIEDETLINKSLSLKK
CSNHEEVSLLEKLQPLQEESDSDDAFVIEPMTFKKTHKTEEAAITKKTLSLKKKMCASQR
KQSCQEESLAVQDVNMEEDSFFMESMSFKKKPKTEESIPTHKLSSLKKKCTIYGKICHFR
KPPVLQTTICGAMSSIKKPTTEKETLFQELSVLQEKHTTEHEMSILKKSLALQKTNFKED
SLVKESLAFKKKPSTEEAIMMPVILKEQCMTEGKRSRLKPLVLQEITSGEKSLIMKPLSI
KEKPSTEKESFSQEPSALQKKHTTQEEVSILKEPSSLLKSPTEESPFDEALAFTKKCTIE
EAPPTKKPLILKRKHATQGTMSHLKKPLILQTTSGEKSLIKEPLPFKEEKVSLKKKCTTQ
EMMSICPELLDFQDMIGEDKNSFFMEPMSFRKNPTTEETVLTKTSLSLQEKKITQGKMSH
LKKPLVLQKITSEEESFYKKLLPFKMKSTTEEKFLSQEPSALKEKHTTLQEVSLSKESLA
IQEKATTEEEFSQELFSLHVKHTNKSGSLFQEALVLQEKTDAEEDSLKNLLALQEKSTME
EESLINKLLALKEELSAEAATNIQTQLSLKKKSTSHGKVFFLKKQLALNETINEEEFLNK
QPLALEGYPSIAEGETLFKKLLAMQEEPSIEKEAVLKEPTIDTEAHFKEPLALQEEPSTE
KEAVLKEPSVDTEAHFKETLALQEKPSIEQEALFKRHSALWEKPSTEKETIFKESLDLQE
KPSIKKETLLKKPLALKMSTINEAVLFEDMIALNEKPTTGKELSFKEPLALQESPTYKED
TFLKTLLVPQVGTSPNVSSTAPESITSKSSIATMTSVGKSGTINEAFLFEDMITLNEKPT
TGKELSFKEPLALQESPTCKEDTFLETFLIPQIGTSPYVFSTTPESITEKSSIATMTSVG
KSRTTTESSACESASDKPVSPQAKGTPKEITPREDIDEDSSDPSFNPMYAKEIFSYMKER
EEQFILTDYMNRQIEITSDMRAILVDWLVEVQVSFEMTHETLYLAVKLVDLYLMKAVCKK
DKLQLLGATAFMIAAKFEEHNSPRVDDFVYICDDNYQRSEVLSMEINILNVLKCDINIPI
AYHFLRRYARCIHTNMKTLTLSRYICEMTLQEYHYVQEKASKLAAASLLLALYMKKLGYW
VPFLEHYSGYSISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKL
EEILNCDCEAQGLVL
NT seq 4188 nt NT seq  +upstreamnt  +downstreamnt
atgctactgccactaccaccccagagctccaaacctgtgcctaagaaatctcagtccagc
aaaattgtgcccagtcatcatgacccatctgaaaagacgggggagaattgccaaacgaag
atatctccatcttcacttcaggagtctccatcttcacttcagggagcactcaaaaagaga
tcagcttttgaagatctcactaatgcttctcaatgtcaacctgtccagcccaagaaagaa
gccaataaagagtttgtaaaagttgtttccaagaagataaacaggaacacacatgctctt
ggactggccaaaaagaataagcggaatctaaaatggcataagctggaagtcacaccagta
gtagcctctactaccgtggtaccaaacattatggagaaaccactcattctagacatatcc
accacctccaaaacacccaacactgaggaggcatctctcttcagaaagccattagtttta
aaggaggaacccactattgaggatgaaacccttatcaataagtcattatctttaaaaaag
tgctcaaatcatgaggaggtgtccttactggaaaagctacagcccctgcaggaggagagt
gacagtgatgatgcgtttgttatagagccaatgacttttaagaagacacataaaactgag
gaggcagccatcaccaagaagacattatccttaaagaagaagatgtgtgcaagtcagcgg
aagcagtcctgccaggaagagtcgttggctgtgcaggatgtcaatatggaagaggattcc
ttctttatggagtcaatgagttttaagaagaagcctaaaactgaggagtcaatccccacc
cataagttatcatctttaaagaagaaatgtaccatttatgggaagatatgccactttagg
aagccaccagtattgcagacaaccatctgtggagcaatgtcctccattaagaagcctacc
actgagaaggagacacttttccaagagctatctgtattgcaagagaaacacaccactgag
catgagatgtccatcttgaagaaatcattggccttgcagaagaccaactttaaagaggat
tcccttgttaaggagtcgttagcctttaagaagaagcctagcactgaggaggcaatcatg
atgccagtaatattgaaggagcagtgcatgactgaggggaagaggtcccgtctgaagcca
ttagtattgcaggagatcacctctggagagaagtcgctcattatgaagccattgtccatt
aaagaaaagccatctactgagaaggagtccttttcccaggaaccatctgcattgcaaaag
aagcacaccactcaggaggaggtttccatcttaaaggagccctcgtccttgctaaagtct
ccaactgaggagtcaccttttgatgaggctttggcttttacaaagaagtgtaccattgag
gaggcaccccccaccaagaagcctttaattttaaagaggaagcatgccactcaggggaca
atgtcccacttgaagaaaccactaatattacagaccacctctggagaaaagtcacttatt
aaggagccactgccctttaaagaagaaaaagtgtctttaaagaaaaagtgtaccacacaa
gagatgatgtccatctgtccagaactgttggactttcaggatatgattggtgaagataag
aattctttctttatggagccaatgtcatttaggaagaaccctacaactgaggagacagta
cttaccaagacatcgttgtctttacaggaaaagaaaattactcaggggaagatgtcccac
ttaaagaagccactggtcttgcagaagatcacttctgaggaggagtcattctataagaag
ctgttgccctttaagatgaaatctacaacggaagaaaagttcctctcccaggaaccatct
gcattgaaagagaagcataccaccttgcaggaagtgtccctctcaaaagagtcattggcc
atccaagagaaggctaccactgaggaggaattctctcaggaactattttcattgcatgtt
aagcataccaacaaaagtgggtccctcttccaggaggctttggtcttgcaagagaagact
gatgccgaagaggattccttgaagaacttgttggctttgcaggagaaaagcaccatggaa
gaagagtcccttatcaataagctattggctctgaaggaggagctttctgctgaggcagcc
acaaacatacagacacaattatctttaaagaagaagtccacttctcatggaaaagtgttc
ttcctgaagaagcagttggctttgaatgagaccatcaatgaagaggagttccttaataag
cagccactggccttggaggggtatcccagcattgcggagggggagaccctcttcaagaag
cttttggccatgcaggaggagcccagcattgagaaggaagctgtcctcaaggagcccact
attgacacagaagctcactttaaggaacctttggccttgcaggaggagcccagcactgag
aaggaggctgtcctcaaggagcccagtgttgacacagaagctcactttaaggaaactttg
gccttgcaggagaagcccagcattgagcaggaggccctctttaagcgacactcagctttg
tgggagaagcccagcactgagaaggagaccatcttcaaggagtctttggacttgcaagag
aagcccagcattaagaaagagaccctcctcaaaaagccattagccttgaagatgtctacc
atcaatgaggcagtcctcttcgaagatatgatagctctgaatgagaaacccaccactggg
aaggagttgtccttcaaggagccattagccttacaagagagtcccacctacaaggaagac
acctttctcaaaacattgttggtcccccaagttggaaccagcccaaatgtgtctagcact
gcccctgaatccataaccagcaagtccagcattgctaccatgaccagtgtgggcaaatct
ggtaccatcaatgaggcattcctcttcgaagatatgataactctgaatgagaaacccacc
actgggaaggagttgtccttcaaggagccattggccttacaagagagtcccacctgcaag
gaagacacctttctggaaacattcttgatcccccaaattggaaccagcccatatgtgttt
agcaccacccctgaatccataacagagaagtccagcattgcaaccatgaccagcgtgggc
aagtccaggaccaccaccgagtccagtgcatgtgaatctgcttctgataaacctgtctca
ccacaggccaagggaacaccaaaggagataaccccacgggaagatattgatgaggacagc
agtgatccaagtttcaacccaatgtatgccaaggaaatcttcagttacatgaaagagaga
gaggaacagtttatacttacagattacatgaacaggcagattgaaatcaccagtgacatg
agggccattcttgtggactggttggtggaggtgcaggtgtcctttgagatgacccatgag
accctgtacttggcagtgaagctggtggatctctacctaatgaaggcagtatgcaagaag
gataagttacaactccttggtgccactgcctttatgattgcagcaaaatttgaggagcac
aactcacctcgtgtggatgactttgtgtacatctgtgatgataattatcagcgatctgag
gtactcagcatggaaatcaacatcctgaacgtcctcaaatgtgacattaacattcccatc
gcctaccattttctgcgcagatatgctaggtgtatccacaccaacatgaagacactgacc
ttgtcccgctacatctgcgagatgaccctgcaggaataccactatgtccaggagaaggct
tccaagctagctgctgcctccttactcctggccctctacatgaagaagctcggatactgg
gttcccttcctggagcattacagtggctacagtatctctgagcttcaccccttggtcaga
cagctgaacaaactgctgactttcagttcttacgatagtctcaaggctgtgtattacaag
tattctcacccggtcttctttgaagtcgccaaaatccctgccttggatatgttgaagctg
gaggagattttgaactgtgattgtgaggctcagggcctggtactctag

DBGET integrated database retrieval system