KEGG   Homo sapiens (human): 8557Help
Entry
8557              CDS       T01001                                 

Gene name
TCAP, CMD1N, LGMD2G, T-cap, TELE, telethonin
Definition
titin-cap
Organism
hsa  Homo sapiens (human)
Disease
H00294  
Dilated cardiomyopathy (DCM)
H00593  
Limb-girdle muscular dystrophy (LGMD)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q12
AA seq 167 aa AA seqDB search
MATSELSCEVSEENCERREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHQQGQCQVL
VQRSPWLMMRMGILGRGLQEYQLPYQRVLPLPIFTPAKMGATKEEREDTPIQLQELLALE
TALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSMSQEAQRG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggctacctcagagctgagctgcgaggtgtcggaggagaactgtgagcgccgggaggcc
ttctgggcagaatggaaggatctgacactgtccacacggcccgaggagggctgctccctg
catgaggaggacacccagagacatgagacctaccaccagcaggggcagtgccaggtgctg
gtgcagcgctcgccctggctgatgatgcggatgggcatcctcggccgtgggctgcaggag
taccagctgccctaccagcgggtactgccgctgcccatcttcacccctgccaagatgggc
gccaccaaggaggagcgtgaggacacccccatccagcttcaggagctgctggcgctggag
acagccctgggtggccagtgtgtggaccgccaggaggtggctgagatcacaaagcagctg
ccccctgtggtgcctgtcagcaagcccggtgcacttcgtcgctccctgtcccgctccatg
tcccaggaagcacagagaggctga

DBGET integrated database retrieval system