KEGG   Homo sapiens (human): 8564Help
Entry
8564              CDS       T01001                                 

Gene name
KMO, dJ317G22.1
Definition
(RefSeq) kynurenine 3-monooxygenase
  KO
K00486  kynurenine 3-monooxygenase [EC:1.14.13.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00380  Tryptophan metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    8564 (KMO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.9  kynurenine 3-monooxygenase
     8564 (KMO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_3 DAO NAD_binding_8 SE Pyr_redox_2 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-GeneID: 8564
NCBI-ProteinID: NP_003670
OMIM: 603538
HGNC: 6381
Ensembl: ENSG00000117009
Vega: OTTHUMG00000039635
Pharos: O15229(Tchem)
UniProt: O15229 A8K693
Structure
PDB: 

Jmol
Position
1q43
AA seq 486 aa AA seqDB search
MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVATFTRGRSINLALSH
RGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLT
AAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKK
PRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMP
FEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCV
LLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLS
MYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK
VINKGLFFLGSLIAISSTYLLIHYMSPRSFLRLRRPWNWIAHFRNTTCFPAKAVDSLEQI
SNLISR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggactcatctgtcattcaaaggaaaaaagtagctgtcattggtggtggcttggttggc
tcattacaagcatgctttcttgcaaagaggaatttccagattgatgtatatgaagctagg
gaagatactcgagtggctaccttcacacgtggaagaagcattaacttagccctttctcat
agaggacgacaagccttgaaagctgttggcctggaagatcagattgtatcccaaggtatt
cccatgagagcaagaatgatccactctctttcaggaaaaaagtctgcaattccctatggg
acaaagtctcagtatattctttctgtaagcagagaaaatctaaacaaggatctattgact
gctgctgagaaataccccaatgtgaaaatgcactttaaccacaggctgttgaaatgtaat
ccagaggaaggaatgatcacagtgcttggatctgacaaagttcccaaagatgtcacttgt
gacctcattgtaggatgtgatggagcctattcaactgtcagatctcacctgatgaagaaa
cctcgctttgattacagtcagcagtacattcctcatgggtacatggagttgactattcca
cctaagaacggagattatgccatggaacctaattatctgcatatttggcctagaaatacc
tttatgatgattgcacttcctaacatgaacaaatcattcacatgtactttgttcatgccc
tttgaagagtttgaaaaacttctaaccagtaatgatgtggtagatttcttccagaaatac
tttccggatgccatccctctaattggagagaaactcctagtgcaagatttcttcctgttg
cctgcccagcccatgatatctgtaaagtgctcttcatttcactttaaatctcactgtgta
ctgctgggagatgcagctcatgctatagtgccgttttttgggcaaggaatgaatgcgggc
tttgaagactgcttggtatttgatgagttaatggataaattcagtaacgaccttagtttg
tgtcttcctgtgttctcaagattgagaatcccagatgatcacgcgatttcagacctatcc
atgtacaattacatagagatgcgagcacatgtcaactcaagctggttcatttttcagaag
aacatggagagatttcttcatgcgattatgccatcgacctttatccctctctatacaatg
gtcactttttccagaataagataccatgaggctgtgcagcgttggcattggcaaaaaaag
gtgataaacaaaggactctttttcttgggatcactgatagccatcagcagtacctaccta
cttatacactacatgtcaccacgatctttcctccgcttgagaagaccatggaactggata
gctcacttccggaatacaacatgtttccccgcaaaggccgtggactccctagaacaaatt
tccaatctcattagcaggtga

DBGET integrated database retrieval system