KEGG   Homo sapiens (human): 8564Help
Entry
8564              CDS       T01001                                 

Gene name
KMO, dJ317G22.1
Definition
(RefSeq) kynurenine 3-monooxygenase
  KO
K00486  
kynurenine 3-monooxygenase [EC:1.14.13.9]
Organism
hsa  Homo sapiens (human)
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    8564 (KMO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.9  kynurenine 3-monooxygenase
     8564 (KMO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O15229(Tchem)
UniProt: 
Position
1q43
AA seq 486 aa AA seqDB search
MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVATFTRGRSINLALSH
RGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLT
AAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKK
PRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMP
FEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCV
LLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLS
MYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK
VINKGLFFLGSLIAISSTYLLIHYMSPRSFLRLRRPWNWIAHFRNTTCFPAKAVDSLEQI
SNLISR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggactcatctgtcattcaaaggaaaaaagtagctgtcattggtggtggcttggttggc
tcattacaagcatgctttcttgcaaagaggaatttccagattgatgtatatgaagctagg
gaagatactcgagtggctaccttcacacgtggaagaagcattaacttagccctttctcat
agaggacgacaagccttgaaagctgttggcctggaagatcagattgtatcccaaggtatt
cccatgagagcaagaatgatccactctctttcaggaaaaaagtctgcaattccctatggg
acaaagtctcagtatattctttctgtaagcagagaaaatctaaacaaggatctattgact
gctgctgagaaataccccaatgtgaaaatgcactttaaccacaggctgttgaaatgtaat
ccagaggaaggaatgatcacagtgcttggatctgacaaagttcccaaagatgtcacttgt
gacctcattgtaggatgtgatggagcctattcaactgtcagatctcacctgatgaagaaa
cctcgctttgattacagtcagcagtacattcctcatgggtacatggagttgactattcca
cctaagaacggagattatgccatggaacctaattatctgcatatttggcctagaaatacc
tttatgatgattgcacttcctaacatgaacaaatcattcacatgtactttgttcatgccc
tttgaagagtttgaaaaacttctaaccagtaatgatgtggtagatttcttccagaaatac
tttccggatgccatccctctaattggagagaaactcctagtgcaagatttcttcctgttg
cctgcccagcccatgatatctgtaaagtgctcttcatttcactttaaatctcactgtgta
ctgctgggagatgcagctcatgctatagtgccgttttttgggcaaggaatgaatgcgggc
tttgaagactgcttggtatttgatgagttaatggataaattcagtaacgaccttagtttg
tgtcttcctgtgttctcaagattgagaatcccagatgatcacgcgatttcagacctatcc
atgtacaattacatagagatgcgagcacatgtcaactcaagctggttcatttttcagaag
aacatggagagatttcttcatgcgattatgccatcgacctttatccctctctatacaatg
gtcactttttccagaataagataccatgaggctgtgcagcgttggcattggcaaaaaaag
gtgataaacaaaggactctttttcttgggatcactgatagccatcagcagtacctaccta
cttatacactacatgtcaccacgatctttcctccgcttgagaagaccatggaactggata
gctcacttccggaatacaacatgtttccccgcaaaggccgtggactccctagaacaaatt
tccaatctcattagcaggtga

DBGET integrated database retrieval system