KEGG   Homo sapiens (human): 857Help
Entry
857               CDS       T01001                                 

Gene name
CAV1, BSCL3, CGL3, LCCNS, MSTP085, PPH3, VIP21, CAV
Definition
(RefSeq) caveolin 1
  KO
K06278  
caveolin 1
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Focal adhesion
Bacterial invasion of epithelial cells
Proteoglycans in cancer
Viral myocarditis
Disease
H00419  
Congenital generalized lipodystrophy (CGL)
H01621  
Pulmonary arterial hypertension (PAH)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    857 (CAV1)
  Cellular commiunity
   04510 Focal adhesion
    857 (CAV1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    857 (CAV1)
  Cardiovascular diseases
   05416 Viral myocarditis
    857 (CAV1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    857 (CAV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q31.1
AA seq 178 aa AA seqDB search
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA
ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggggcaaatacgtagactcggagggacatctctacaccgttcccatccgggaa
cagggcaacatctacaagcccaacaacaaggccatggcagacgagctgagcgagaagcaa
gtgtacgacgcgcacaccaaggagatcgacctggtcaaccgcgaccctaaacacctcaac
gatgacgtggtcaagattgactttgaagatgtgattgcagaaccagaagggacacacagt
tttgacggcatttggaaggccagcttcaccaccttcactgtgacgaaatactggttttac
cgcttgctgtctgccctctttggcatcccgatggcactcatctggggcatttacttcgcc
attctctctttcctgcacatctgggcagttgtaccatgcattaagagcttcctgattgag
attcagtgcatcagccgtgtctattccatctacgtccacaccgtctgtgacccactcttt
gaagctgttgggaaaatattcagcaatgtccgcatcaacttgcagaaagaaatataa

DBGET integrated database retrieval system