KEGG   Homo sapiens (human): 8600Help
Entry
8600              CDS       T01001                                 

Gene name
TNFSF11, CD254, ODF, OPGL, OPTB2, RANKL, TRANCE, hRANKL2, sOdf
Definition
tumor necrosis factor (ligand) superfamily, member 11
Orthology
K05473  
tumor necrosis factor ligand superfamily member 11
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Osteoclast differentiation
Prolactin signaling pathway
Rheumatoid arthritis
Disease
H00436  
Osteopetrosis
Drug target
Denosumab: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    8600 (TNFSF11)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8600 (TNFSF11)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    8600 (TNFSF11)
  Development
   04380 Osteoclast differentiation
    8600 (TNFSF11)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    8600 (TNFSF11)
Cellular antigens [BR:hsa04090]
 Proteins
  8600 (TNFSF11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q14
AA seq 317 aa AA seqDB search
MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQV
VCSVALFFYFRAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIK
QAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSH
KVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMV
YVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLD
PDQDATYFGAFKVRDID
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgccagcagagactacaccaagtacctgcgtggctcggaggagatgggcggc
ggccccggagccccgcacgagggccccctgcacgccccgccgccgcctgcgccgcaccag
ccccctgccgcctcccgctccatgttcgtggccctcctggggctggggctgggccaggtt
gtctgcagcgtcgccctgttcttctatttcagagcgcagatggatcctaatagaatatca
gaagatggcactcactgcatttatagaattttgagactccatgaaaatgcagattttcaa
gacacaactctggagagtcaagatacaaaattaatacctgattcatgtaggagaattaaa
caggcctttcaaggagctgtgcaaaaggaattacaacatatcgttggatcacagcacatc
agagcagagaaagcgatggtggatggctcatggttagatctggccaagaggagcaagctt
gaagctcagccttttgctcatctcactattaatgccaccgacatcccatctggttcccat
aaagtgagtctgtcctcttggtaccatgatcggggttgggccaagatctccaacatgact
tttagcaatggaaaactaatagttaatcaggatggcttttattacctgtatgccaacatt
tgctttcgacatcatgaaacttcaggagacctagctacagagtatcttcaactaatggtg
tacgtcactaaaaccagcatcaaaatcccaagttctcataccctgatgaaaggaggaagc
accaagtattggtcagggaattctgaattccatttttattccataaacgttggtggattt
tttaagttacggtctggagaggaaatcagcatcgaggtctccaacccctccttactggat
ccggatcaggatgcaacatactttggggcttttaaagttcgagatatagattga

DBGET integrated database retrieval system