KEGG   Homo sapiens (human): 8613Help
Entry
8613              CDS       T01001                                 

Gene name
PLPP3, Dri42, LPP3, PAP2B, PPAP2B, VCIP
Definition
(RefSeq) phospholipid phosphatase 3
  KO
K01080  
phosphatidate phosphatase [EC:3.1.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Ether lipid metabolism
Sphingolipid metabolism
Metabolic pathways
Phospholipase D signaling pathway
Fc gamma R-mediated phagocytosis
Fat digestion and absorption
Choline metabolism in cancer
Module
Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
  Lipid metabolism
   00561 Glycerolipid metabolism
    8613 (PLPP3)
   00564 Glycerophospholipid metabolism
    8613 (PLPP3)
   00565 Ether lipid metabolism
    8613 (PLPP3)
   00600 Sphingolipid metabolism
    8613 (PLPP3)
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    8613 (PLPP3)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    8613 (PLPP3)
  Digestive system
   04975 Fat digestion and absorption
    8613 (PLPP3)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    8613 (PLPP3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     8613 (PLPP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O14495(Tbio)
UniProt: 
Position
1p32.2
AA seq 311 aa AA seqDB search
MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIK
PYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQN
PYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYR
CRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFY
TGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRKEILSPVD
IIDRNNHHNMM
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaactacaagtacgacaaagcgatcgtcccggagagcaagaacggcggcagcccg
gcgctcaacaacaacccgaggaggagcggcagcaagcgggtgctgctcatctgcctcgac
ctcttctgcctcttcatggcgggcctccccttcctcatcatcgagacaagcaccatcaag
ccttaccaccgagggttttactgcaatgatgagagcatcaagtacccactgaaaactggt
gagacaataaatgacgctgtgctctgtgccgtggggatcgtcattgccatcctcgcgatc
atcacgggggaattctaccggatctattacctgaagaagtcgcggtcgacgattcagaac
ccctacgtggcagcactctataagcaagtgggctgcttcctctttggctgtgccatcagc
cagtctttcacagacattgccaaagtgtccatagggcgcctgcgtcctcacttcttgagt
gtctgcaaccctgatttcagccagatcaactgctctgaaggctacattcagaactacaga
tgcagaggtgatgacagcaaagtccaggaagccaggaagtccttcttctctggccatgcc
tccttctccatgtacactatgctgtatttggtgctatacctgcaggcccgcttcacttgg
cgaggagcccgcctgctccggcccctcctgcagttcaccttgatcatgatggccttctac
acgggactgtctcgcgtatcagaccacaagcaccatcccagtgatgttctggcaggattt
gctcaaggagccctggtggcctgctgcatagttttcttcgtgtctgacctcttcaagact
aagacgacgctctccctgcctgcccctgctatccggaaggaaatcctttcacctgtggac
attattgacaggaacaatcaccacaacatgatgtag

DBGET integrated database retrieval system