KEGG   Homo sapiens (human): 8613Help
Entry
8613              CDS       T01001                                 

Gene name
PPAP2B, Dri42, LPP3, PAP2B, VCIP
Definition
phosphatidic acid phosphatase type 2B (EC:3.1.3.4)
Orthology
K01080  
phosphatidate phosphatase [EC:3.1.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Ether lipid metabolism
Sphingolipid metabolism
Metabolic pathways
Fc gamma R-mediated phagocytosis
Fat digestion and absorption
Module
Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    8613 (PPAP2B)
   00564 Glycerophospholipid metabolism
    8613 (PPAP2B)
   00565 Ether lipid metabolism
    8613 (PPAP2B)
   00600 Sphingolipid metabolism
    8613 (PPAP2B)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    8613 (PPAP2B)
  Digestive system
   04975 Fat digestion and absorption
    8613 (PPAP2B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     8613 (PPAP2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p32.2
AA seq 311 aa AA seqDB search
MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIK
PYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQN
PYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYR
CRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFY
TGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRKEILSPVD
IIDRNNHHNMM
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaactacaagtacgacaaagcgatcgtcccggagagcaagaacggcggcagcccg
gcgctcaacaacaacccgaggaggagcggcagcaagcgggtgctgctcatctgcctcgac
ctcttctgcctcttcatggcgggcctccccttcctcatcatcgagacaagcaccatcaag
ccttaccaccgagggttttactgcaatgatgagagcatcaagtacccactgaaaactggt
gagacaataaatgacgctgtgctctgtgccgtggggatcgtcattgccatcctcgcgatc
atcacgggggaattctaccggatctattacctgaagaagtcgcggtcgacgattcagaac
ccctacgtggcagcactctataagcaagtgggctgcttcctctttggctgtgccatcagc
cagtctttcacagacattgccaaagtgtccatagggcgcctgcgtcctcacttcttgagt
gtctgcaaccctgatttcagccagatcaactgctctgaaggctacattcagaactacaga
tgcagaggtgatgacagcaaagtccaggaagccaggaagtccttcttctctggccatgcc
tccttctccatgtacactatgctgtatttggtgctatacctgcaggcccgcttcacttgg
cgaggagcccgcctgctccggcccctcctgcagttcaccttgatcatgatggccttctac
acgggactgtctcgcgtatcagaccacaagcaccatcccagtgatgttctggcaggattt
gctcaaggagccctggtggcctgctgcatagttttcttcgtgtctgacctcttcaagact
aagacgacgctctccctgcctgcccctgctatccggaaggaaatcctttcacctgtggac
attattgacaggaacaatcaccacaacatgatgtag

DBGET integrated database retrieval system