KEGG   Homo sapiens (human): 8648Help
Entry
8648              CDS       T01001                                 

Gene name
NCOA1, F-SRC-1, KAT13A, RIP160, SRC1, bHLHe42, bHLHe74
Definition
nuclear receptor coactivator 1 (EC:2.3.1.48)
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
Thyroid hormone signaling pathway
Class
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p23
AA seq 1441 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINR
QQSSDLHSSSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTG
ISLAQFMSPRRQVTSGLATRPRMPNNSFPPNISTLSSPVGMTSSACNNNNRSYSNIPVTS
LQGMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN
SSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSC
TGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVS
VTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
MDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAV
TSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAIN
QSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLIMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLGT
MPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSF
GNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLAN
RNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPI
PPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVS
MAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTE
ADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLT
E
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcggggacagttcatccgaccctgctaacccagactcacataagaggaaa
ggatcgccatgtgacacactggcatcaagcacggaaaagaggcgcagggagcaagaaaat
aaatatttagaagaactagctgagttactgtctgccaacattagtgacattgacagcttg
agtgtaaaaccagacaaatgcaagattttgaagaaaacagtcgatcagatacagctaatg
aagagaatggaacaagagaaatcaacaactgatgacgatgtacagaaatcagacatctca
tcaagtagtcaaggagtgatagaaaaggaatccttgggacctcttcttttggaggctttg
gatggatttttctttgttgtgaactgtgaagggagaattgtatttgtgtcagagaatgta
accagctacttaggttacaatcaggaggaattaatgaatacgagcgtctacagcatactg
cacgtgggggatcatgcagaatttgtgaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgacgaaatagccatacctttaactgcaggatgcta
attcaccctccagatgagccagggaccgagaaccaagaagcttgccagcgttatgaagta
atgcagtgtttcactgtgtcacagccaaaatcaattcaagaggatggagaagatttccag
tcatgtctgatttgtattgcacggcgattacctcggcctccagctattacgggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgatactagttccctg
agagctgctggcagaactggttgggaagatttagtgaggaagtgcatttatgcttttttc
caacctcagggcagagaaccatcttatgccagacagctgttccaagaagtgatgactcgt
ggcactgcctccagcccctcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggagcacagtgggctttctcctcaagatgacactaattctgga
atgtcaattccccgagtaaatccctcggtcaatcctagtatctctccagctcatggtgtg
gctcgttcatccacattgccaccatccaacagcaacatggtatccaccagaataaaccgc
cagcagagctcagaccttcatagcagcagtcatagtaattctagcaacagccaaggaagt
ttcggatgctcacccggaagtcagattgtagccaatgttgccttaaaccaaggacaggcc
agttcacagagcagtaatccctctttaaacctcaataattctcctatggaaggtacagga
atatccctagcacagttcatgtctccaaggagacaggttacttctggattggcaacaagg
cccaggatgccaaacaattcctttcctcctaatatttcgacattaagctctcccgttggc
atgacaagtagtgcctgtaataataataaccgatcttattcaaacatcccagtaacatct
ttacagggtatgaatgaaggacccaataactccgttggcttctctgccagttctccagtc
ctcaggcagatgagctcacagaattcacctagcagattaaatatacaaccagcaaaagct
gagtccaaagataacaaagagattgcctcaattttaaatgaaatgattcaatctgacaac
agctctagtgatggcaaacctctggattcagggcttctgcataacaatgacagactttca
gatggagacagtaaatactctcaaaccagtcacaaactagtgcagcttttgacaacaact
gccgaacagcagttacggcatgctgatatagacacaagctgcaaagatgtcctgtcttgc
acaggcacttccaactctgcctctgctaactcttcaggaggttcttgtccctcttctcat
agctcattgacagaacggcataaaattctacaccggctcttacaggagggtagcccctca
gatatcaccactttgtctgtcgagcctgataaaaaggacagtgcatctacttctgtgtca
gtgactggacaggtacaaggaaactccagtataaaactagaactggatgcttcaaagaaa
aaagaatcaaaagaccatcagctcctacgctatcttttagataaagatgagaaagattta
agatcaactccaaacctgagcctggatgatgtaaaggtgaaagtggaaaagaaagaacag
atggatccatgtaatacaaacccaaccccaatgaccaaacccactcctgaggaaataaaa
ctggaggcccagagccagtttacagctgaccttgaccagtttgatcagttactgcccacg
ctggagaaggcagcacagttgccaggcttatgtgagacagacaggatggatggtgcggtc
accagtgtaaccatcaaatcggagatcctgccagcttcacttcagtccgccactgccaga
cccacttccaggctaaatagattacctgagctggaattggaagcaattgataaccaattt
ggacaaccaggaacaggcgatcagattccatggacaaataatacagtgacagctataaat
cagagtaaatcagaagaccagtgtattagctcacaattagatgagcttctctgtccaccc
acaacagtagaagggagaaatgatgagaaggctcttcttgaacagctggtatccttcctt
agtggcaaagatgaaactgagctagctgaactagacagagctctgggaattgacaaactt
gttcaggggggtggattagatgtattatcagagagatttccaccacaacaagcaacgcca
cctttgatcatggaagaaagacccaacctttattcccagccttactcttctccttctcct
actgccaatctccctagccctttccaaggcatggtcaggcaaaaaccttcactggggacg
atgcctgttcaagtaacacctccccgaggtgctttttcacctggcatgggcatgcagccc
aggcaaactctaaacagacctccggctgcacctaaccagcttcgacttcaactacagcag
cgattacagggacaacagcagttgatacaccaaaatcggcaagctatcttaaaccagttt
gcagcaactgctcctgttggcatcaatatgagatcaggcatgcaacagcaaattacacct
cagccacccctgaatgctcaaatgttggcacaacgtcagcgggaactgtacagtcaacag
caccgacagaggcagctaatacagcagcaaagagccatgcttatgaggcagcaaagcttt
gggaacaacctccctccctcatctggactaccagttcaaatggggaacccccgtcttcct
cagggtgctccacagcaattcccctatccaccaaactatggtacaaatccaggaacccca
cctgcttctaccagcccgttttcacaactagcagcaaatcctgaagcatccttggccaac
cgcaacagcatggtgagcagaggcatgacaggaaacataggaggacagtttggcactgga
atcaatcctcagatgcagcagaatgtcttccagtatccaggagcaggaatggttccccaa
ggtgaggccaactttgctccatctctaagccctgggagctccatggtgccgatgccaatc
cctcctcctcagagttctcttctccagcaaactccacctgcctccgggtatcagtcacca
gacatgaaggcctggcagcaaggagcgataggaaacaacaatgtgttcagtcaagctgtc
cagaaccagcccacgcctgcacagccaggagtatacaacaacatgagcatcaccgtttcc
atggcaggtggaaatacgaatgttcagaacatgaacccaatgatggcccagatgcagatg
agctctttgcagatgccaggaatgaacactgtgtgccctgagcagataaatgatcccgca
ctgagacacacaggcctctactgcaaccagctctcatccactgaccttctcaaaacagaa
gcagatggaacccagcaggtgcaacaggttcaggtgtttgctgacgtccagtgtacagtg
aatctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaagccc
acgtcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactgact
gaataa

DBGET integrated database retrieval system