KEGG   Homo sapiens (human): 8651Help
Entry
8651              CDS       T01001                                 

Gene name
SOCS1, CIS1, CISH1, JAB, SOCS-1, SSI-1, SSI1, TIP3
Definition
suppressor of cytokine signaling 1
Orthology
K04694  
suppressor of cytokine signaling 1
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Osteoclast differentiation
Jak-STAT signaling pathway
Insulin signaling pathway
Prolactin signaling pathway
Type II diabetes mellitus
Toxoplasmosis
MicroRNAs in cancer
Module
ECS complex
JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8651 (SOCS1)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    8651 (SOCS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    8651 (SOCS1)
   04917 Prolactin signaling pathway
    8651 (SOCS1)
  Development
   04380 Osteoclast differentiation
    8651 (SOCS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    8651 (SOCS1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    8651 (SOCS1)
  Infectious diseases
   05145 Toxoplasmosis
    8651 (SOCS1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   ECS complex
    target recognizing subunit (SOCS box)
     8651 (SOCS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.13
AA seq 211 aa AA seqDB search
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRS
HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA
SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ
RIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggtagcacacaaccaggtggcagccgacaatgcagtctccacagcagcagagccccga
cggcggccagaaccttcctcctcttcctcctcctcgcccgcggcccccgcgcgcccgcgg
ccgtgccccgcggtcccggccccggcccccggcgacacgcacttccgcacattccgttcg
cacgccgattaccggcgcatcacgcgcgccagcgcgctcctggacgcctgcggattctac
tgggggcccctgagcgtgcacggggcgcacgagcggctgcgcgccgagcccgtgggcacc
ttcctggtgcgcgacagccgccagcggaactgctttttcgcccttagcgtgaagatggcc
tcgggacccacgagcatccgcgtgcactttcaggccggccgctttcacctggatggcagc
cgcgagagcttcgactgcctcttcgagctgctggagcactacgtggcggcgccgcgccgc
atgctgggggccccgctgcgccagcgccgcgtgcggccgctgcaggagctgtgccgccag
cgcatcgtggccaccgtgggccgcgagaacctggctcgcatccccctcaaccccgtcctc
cgcgactacctgagctccttccccttccagatttga

DBGET integrated database retrieval system