KEGG   Homo sapiens (human): 8651Help
Entry
8651              CDS       T01001                                 

Gene name
SOCS1, CIS1, CISH1, JAB, SOCS-1, SSI-1, SSI1, TIP3
Definition
suppressor of cytokine signaling 1
Orthology
K04694  
suppressor of cytokine signaling 1
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Osteoclast differentiation
Jak-STAT signaling pathway
Insulin signaling pathway
Prolactin signaling pathway
Type II diabetes mellitus
Toxoplasmosis
MicroRNAs in cancer
Module
ECS complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:hsa04917]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:hsa04930]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.13
AA seq 211 aa AA seqDB search
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRS
HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA
SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ
RIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggtagcacacaaccaggtggcagccgacaatgcagtctccacagcagcagagccccga
cggcggccagaaccttcctcctcttcctcctcctcgcccgcggcccccgcgcgcccgcgg
ccgtgccccgcggtcccggccccggcccccggcgacacgcacttccgcacattccgttcg
cacgccgattaccggcgcatcacgcgcgccagcgcgctcctggacgcctgcggattctac
tgggggcccctgagcgtgcacggggcgcacgagcggctgcgcgccgagcccgtgggcacc
ttcctggtgcgcgacagccgccagcggaactgctttttcgcccttagcgtgaagatggcc
tcgggacccacgagcatccgcgtgcactttcaggccggccgctttcacctggatggcagc
cgcgagagcttcgactgcctcttcgagctgctggagcactacgtggcggcgccgcgccgc
atgctgggggccccgctgcgccagcgccgcgtgcggccgctgcaggagctgtgccgccag
cgcatcgtggccaccgtgggccgcgagaacctggctcgcatccccctcaaccccgtcctc
cgcgactacctgagctccttccccttccagatttga

DBGET integrated database retrieval system