KEGG   Homo sapiens (human): 867Help
Entry
867               CDS       T01001                                 

Gene name
CBL, C-CBL, CBL2, FRA11B, NSLL, RNF55
Definition
Cbl proto-oncogene, E3 ubiquitin protein ligase
Orthology
K04707  
E3 ubiquitin-protein ligase CBL [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ubiquitin mediated proteolysis
Endocytosis
Jak-STAT signaling pathway
T cell receptor signaling pathway
Insulin signaling pathway
Bacterial invasion of epithelial cells
Pathways in cancer
Proteoglycans in cancer
Chronic myeloid leukemia
Disease
H00523  
Noonan syndrome and related disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    867 (CBL)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    867 (CBL)
   04630 Jak-STAT signaling pathway
    867 (CBL)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    867 (CBL)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    867 (CBL)
  Endocrine system
   04910 Insulin signaling pathway
    867 (CBL)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    867 (CBL)
   05205 Proteoglycans in cancer
    867 (CBL)
   05220 Chronic myeloid leukemia
    867 (CBL)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    867 (CBL)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     867 (CBL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23.3
AA seq 906 aa AA seqDB search
MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCW
KLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFME
NLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFR
ITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFE
FDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRL
GQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDH
IKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCR
CEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVER
PPSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTLR
DLPPPPPPDRPYSVGAESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPV
SAPSSSDPWTGRELTNRHSLPFSLPSQMEPRPDVPRLGSTFSLDTSMSMNSSPLVGPECD
HPKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRAC
DCDQQIDSCTYEAMYNIQSQAPSITESSTFGEGNLAAAHANTGPEESENEDDGYDVPKPP
VPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSC
QQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISS
PAHVAT
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaacgtgaagaagagctctggggccgggggcggcagcggctccgggggctcg
ggttcgggtggcctgattgggctcatgaaggacgccttccagccgcaccaccaccaccac
caccacctcagcccccacccgccggggacggtggacaagaagatggtggagaagtgctgg
aagctcatggacaaggtggtgcggttgtgtcagaacccaaagctggcgctaaagaatagc
ccaccttatatcttagacctgctaccagatacctaccagcatctccgtactatcttgtca
agatatgaggggaagatggagacacttggagaaaatgagtattttagggtgtttatggag
aatttgatgaagaaaactaagcaaaccataagcctcttcaaggagggaaaagaaagaatg
tatgaggagaattctcagcctaggcgaaacctaaccaaactgtccctcatcttcagccac
atgctggcagaactaaaaggaatctttccaagtggactctttcagggagacacatttcgg
attactaaagcagatgctgcggaattttggagaaaagcttttggggaaaagacaatagtc
ccttggaagagctttcgacaggctctacatgaagtgcatcccatcagttctgggctggag
gccatggctctgaaatccactattgatctgacctgcaatgattatatttcggtttttgaa
tttgacatctttacccgactctttcagccctggtcctctttgctcaggaattggaacagc
cttgctgtaactcatcctggctacatggcttttttgacgtatgacgaagtgaaagctcgg
ctccagaaattcattcacaaacctggcagttatatcttccggctgagctgtactcgtctg
ggtcagtgggctattgggtatgttactgctgatgggaacattctccagacaatccctcac
aataaacctctcttccaagcactgattgatggcttcagggaaggcttctatttgtttcct
gatggacgaaatcagaatcctgatctgactggcttatgtgaaccaactccccaagaccat
atcaaagtgacccaggaacaatatgaattatactgtgagatgggctccacattccaacta
tgtaaaatatgtgctgaaaatgataaggatgtaaagattgagccctgtggacacctcatg
tgcacatcctgtcttacatcctggcaggaatcagaaggtcagggctgtcctttctgccga
tgtgaaattaaaggtactgaacccatcgtggtagatccgtttgatcctagagggagtggc
agcctgttgaggcaaggagcagagggagctccctccccaaattatgatgatgatgatgat
gaacgagctgatgatactctcttcatgatgaaggaattggctggtgccaaggtggaacgg
ccgccttctccattctccatggccccacaagcttcccttcccccggtgccaccacgactt
gaccttctgccgcagcgagtatgtgttccctcaagtgcttctgctcttggaactgcttct
aaggctgcttctggctcccttcataaagacaaaccattgccagtacctcccacacttcga
gatcttccaccaccaccgcctccagaccggccatattctgttggagcagaatcccgacct
caaagacgccccttgccttgtacaccaggcgactgtccctccagagacaaactgccccct
gtcccctctagccgccttggagactcatggctgccccggccaatccccaaagtaccagta
tctgccccaagttccagtgatccctggacaggaagagaattaaccaaccggcactcactt
ccattttcattgccctcacaaatggagcccagaccagatgtgcctaggctcggaagcacg
ttcagtctggatacctccatgagtatgaatagcagcccattagtaggtccagagtgtgac
caccccaaaatcaaaccttcctcatctgccaatgccatttattctctggctgccagacct
cttcctgtgccaaaactgccacctggggagcaatgtgagggtgaagaggacacagagtac
atgactccctcttccaggcctctacggcctttggatacatcccagagttcacgagcatgt
gattgcgaccagcagattgatagctgtacgtatgaagcaatgtataatattcagtcccag
gcgccatctatcaccgagagcagcacctttggtgaagggaatttggccgcagcccatgcc
aacactggtcccgaggagtcagaaaatgaggatgatgggtatgatgtcccaaagccacct
gtgccggccgtgctggcccgccgaactctctcagatatctctaatgccagctcctccttt
ggctggttgtctctggatggtgatcctacaacaaatgtcactgaaggttcccaagttccc
gagaggcctccaaaaccattcccgcggagaatcaactctgaacggaaagctggcagctgt
cagcaaggtagtggtcctgccgcctctgctgccaccgcctcacctcagctctccagtgag
atcgagaacctcatgagtcaggggtactcctaccaggacatccagaaagctttggtcatt
gcccagaacaacatcgagatggccaaaaacatcctccgggaatttgtttccatttcttct
cctgcccatgtagctacctag

DBGET integrated database retrieval system