KEGG   Homo sapiens (human): 867Help
Entry
867               CDS       T01001                                 

Gene name
CBL, C-CBL, CBL2, FRA11B, NSLL, RNF55
Definition
Cbl proto-oncogene, E3 ubiquitin protein ligase
Orthology
K04707  
E3 ubiquitin-protein ligase CBL [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ubiquitin mediated proteolysis
Endocytosis
Jak-STAT signaling pathway
T cell receptor signaling pathway
Insulin signaling pathway
Bacterial invasion of epithelial cells
Pathways in cancer
Proteoglycans in cancer
Chronic myeloid leukemia
Disease
H00523  
Noonan syndrome and related disorders
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:hsa04012]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:hsa05220]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23.3
AA seq 906 aa AA seqDB search
MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCW
KLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFME
NLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFR
ITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFE
FDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRL
GQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDH
IKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCR
CEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVER
PPSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTLR
DLPPPPPPDRPYSVGAESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPV
SAPSSSDPWTGRELTNRHSLPFSLPSQMEPRPDVPRLGSTFSLDTSMSMNSSPLVGPECD
HPKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRAC
DCDQQIDSCTYEAMYNIQSQAPSITESSTFGEGNLAAAHANTGPEESENEDDGYDVPKPP
VPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSC
QQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISS
PAHVAT
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaacgtgaagaagagctctggggccgggggcggcagcggctccgggggctcg
ggttcgggtggcctgattgggctcatgaaggacgccttccagccgcaccaccaccaccac
caccacctcagcccccacccgccggggacggtggacaagaagatggtggagaagtgctgg
aagctcatggacaaggtggtgcggttgtgtcagaacccaaagctggcgctaaagaatagc
ccaccttatatcttagacctgctaccagatacctaccagcatctccgtactatcttgtca
agatatgaggggaagatggagacacttggagaaaatgagtattttagggtgtttatggag
aatttgatgaagaaaactaagcaaaccataagcctcttcaaggagggaaaagaaagaatg
tatgaggagaattctcagcctaggcgaaacctaaccaaactgtccctcatcttcagccac
atgctggcagaactaaaaggaatctttccaagtggactctttcagggagacacatttcgg
attactaaagcagatgctgcggaattttggagaaaagcttttggggaaaagacaatagtc
ccttggaagagctttcgacaggctctacatgaagtgcatcccatcagttctgggctggag
gccatggctctgaaatccactattgatctgacctgcaatgattatatttcggtttttgaa
tttgacatctttacccgactctttcagccctggtcctctttgctcaggaattggaacagc
cttgctgtaactcatcctggctacatggcttttttgacgtatgacgaagtgaaagctcgg
ctccagaaattcattcacaaacctggcagttatatcttccggctgagctgtactcgtctg
ggtcagtgggctattgggtatgttactgctgatgggaacattctccagacaatccctcac
aataaacctctcttccaagcactgattgatggcttcagggaaggcttctatttgtttcct
gatggacgaaatcagaatcctgatctgactggcttatgtgaaccaactccccaagaccat
atcaaagtgacccaggaacaatatgaattatactgtgagatgggctccacattccaacta
tgtaaaatatgtgctgaaaatgataaggatgtaaagattgagccctgtggacacctcatg
tgcacatcctgtcttacatcctggcaggaatcagaaggtcagggctgtcctttctgccga
tgtgaaattaaaggtactgaacccatcgtggtagatccgtttgatcctagagggagtggc
agcctgttgaggcaaggagcagagggagctccctccccaaattatgatgatgatgatgat
gaacgagctgatgatactctcttcatgatgaaggaattggctggtgccaaggtggaacgg
ccgccttctccattctccatggccccacaagcttcccttcccccggtgccaccacgactt
gaccttctgccgcagcgagtatgtgttccctcaagtgcttctgctcttggaactgcttct
aaggctgcttctggctcccttcataaagacaaaccattgccagtacctcccacacttcga
gatcttccaccaccaccgcctccagaccggccatattctgttggagcagaatcccgacct
caaagacgccccttgccttgtacaccaggcgactgtccctccagagacaaactgccccct
gtcccctctagccgccttggagactcatggctgccccggccaatccccaaagtaccagta
tctgccccaagttccagtgatccctggacaggaagagaattaaccaaccggcactcactt
ccattttcattgccctcacaaatggagcccagaccagatgtgcctaggctcggaagcacg
ttcagtctggatacctccatgagtatgaatagcagcccattagtaggtccagagtgtgac
caccccaaaatcaaaccttcctcatctgccaatgccatttattctctggctgccagacct
cttcctgtgccaaaactgccacctggggagcaatgtgagggtgaagaggacacagagtac
atgactccctcttccaggcctctacggcctttggatacatcccagagttcacgagcatgt
gattgcgaccagcagattgatagctgtacgtatgaagcaatgtataatattcagtcccag
gcgccatctatcaccgagagcagcacctttggtgaagggaatttggccgcagcccatgcc
aacactggtcccgaggagtcagaaaatgaggatgatgggtatgatgtcccaaagccacct
gtgccggccgtgctggcccgccgaactctctcagatatctctaatgccagctcctccttt
ggctggttgtctctggatggtgatcctacaacaaatgtcactgaaggttcccaagttccc
gagaggcctccaaaaccattcccgcggagaatcaactctgaacggaaagctggcagctgt
cagcaaggtagtggtcctgccgcctctgctgccaccgcctcacctcagctctccagtgag
atcgagaacctcatgagtcaggggtactcctaccaggacatccagaaagctttggtcatt
gcccagaacaacatcgagatggccaaaaacatcctccgggaatttgtttccatttcttct
cctgcccatgtagctacctag

DBGET integrated database retrieval system