KEGG   Homo sapiens (human): 8671Help
Entry
8671              CDS       T01001                                 

Gene name
SLC4A4, HNBC1, KNBC, NBC1, NBC2, NBCe1-A, SLC4A5, hhNMC, pNBC
Definition
solute carrier family 4 (sodium bicarbonate cotransporter), member 4
Orthology
K13575  
solute carrier family 4 (sodium bicarbonate cotransporter), member 4
Organism
hsa  Homo sapiens (human)
Pathway
Proximal tubule bicarbonate reclamation
Pancreatic secretion
Bile secretion
Disease
H00429  
Proximal renal tubular acidosis (RTA type 2)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    8671 (SLC4A4)
   04976 Bile secretion
    8671 (SLC4A4)
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    8671 (SLC4A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21
AA seq 1079 aa AA seqDB search
MEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRHKRKTGHKEKKEKERI
SENYSDKSDIENADESSSSILKPLISPAAERIRFILGEEDDSPAPPQLFTELDELLAVDG
QEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLP
QLVEMIVDHQIETGLLKPELKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTN
PDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDTPFI
AFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKA
KDRHDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTP
HDGGHGGGGHGDCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLAT
VTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLF
NFSKDNNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDA
FKKMIKLADYYPINSNFKVGYNTLFSCTCVPPDPANISISNDTTLAPEYLPTMSSTDMYH
NTTFDWAFLSKKECSKYGGNLVGNNCNFVPDITLMSFILFLGTYTSSMALKKFKTSPYFP
TTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPNRGWFVPPFGENPWWV
CLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVICSLMALPW
YVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFI
PMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLC
LALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKK
KKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTSC
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgaagctgtcctggacagaggggcttccttcctcaagcatgtgtgtgatgaa
gaagaagtagaaggccaccataccatttacatcggagtccatgtgccgaagagttacagg
agaaggagacgtcacaagagaaagacagggcacaaagaaaagaaggaaaaggagagaatc
tctgagaactactctgacaaatcagatattgaaaatgctgatgaatccagcagcagcatc
ctaaaacctctcatctctcctgctgcagaacgcatccgattcatcttgggagaggaggat
gacagcccagctccccctcagctcttcacggaactggatgagctgctggccgtggatggg
caggagatggagtggaaggaaacagccaggtggatcaagtttgaagaaaaagtggaacag
ggtggggaaagatggagcaagccccatgtggccacattgtcccttcatagtttatttgag
ctgaggacatgtatggagaaaggatccatcatgcttgatcgggaggcttcttctctccca
cagttggtggagatgattgttgaccatcagattgagacaggcctattgaaacctgaactt
aaggataaggtgacctatactttgctccggaagcaccggcatcaaaccaagaaatccaac
cttcggtccctggctgacattgggaagacagtctccagtgcaagtaggatgtttaccaac
cctgataatggtagcccagccatgacccataggaatctgacttcctccagtctgaatgac
atttctgataaaccggagaaggaccagctgaagaataagttcatgaaaaaattgccacgt
gatgcagaagcttccaacgtgcttgttggggaggttgactttttggatactcctttcatt
gcctttgttaggctacagcaggctgtcatgctgggtgccctgactgaagttcctgtgccc
acaaggttcttgttcattctcttaggtcctaaggggaaagccaagtcctaccacgagatt
ggcagagccattgccaccctgatgtctgatgaggtgttccatgacattgcttataaagca
aaagacaggcacgacctgattgctggtattgatgagttcctagatgaagtcatcgtcctt
ccacctggggaatgggatccagcaattaggatagagcctcctaagagtcttccatcctct
gacaaaagaaagaatatgtactcaggtggagagaatgttcagatgaatggggatacgccc
catgatggaggtcacggaggaggaggacatggggattgtgaagaattgcagcgaactgga
cggttctgtggtggactaattaaagacataaagaggaaagcgccattttttgccagtgat
ttttatgatgctttaaatattcaagctctttcggcaattctcttcatttatctggcaact
gtaactaatgctatcacttttggaggactgcttggggatgccactgacaacatgcagggc
gtgttggagagtttcctgggcactgctgtctctggagccatcttttgcctttttgctggt
caaccactcactattctgagcagcaccggacctgtcctagtttttgagaggcttctattt
aatttcagcaaggacaataattttgactatttggagtttcgcctttggattggcctgtgg
tccgccttcctatgtctcattttggtagccactgatgccagcttcttggttcaatacttc
acacgtttcacggaggagggcttttcctctctgattagcttcatctttatctatgatgct
ttcaagaagatgatcaagcttgcagattactaccccatcaactccaacttcaaagtgggc
tacaacactctcttttcctgtacctgtgtgccacctgacccagctaatatctcaatatct
aatgacaccacactggccccagagtatttgccaactatgtcttctactgacatgtaccat
aatactacctttgactgggcatttttgtcgaagaaggagtgttcaaaatacggaggaaac
ctcgtcgggaacaactgtaattttgttcctgatatcacactcatgtcttttatcctcttc
ttgggaacctacacctcttccatggctctgaaaaaattcaaaactagtccttattttcca
accacagcaagaaaactgatcagtgattttgccattatcttgtccattctcatcttttgt
gtaatagatgccctagtaggcgtggacaccccaaaactaattgtgccaagtgagttcaag
ccaacaagtccaaaccgaggttggttcgttccaccgtttggagaaaacccctggtgggtg
tgccttgctgctgctatcccggctttgttggtcactatactgattttcatggaccaacaa
attacagctgtgattgtaaacaggaaagaacataaactcaagaaaggagcagggtatcac
ttggatctcttttgggtggccatcctcatggttatatgctccctcatggctcttccgtgg
tatgtagctgctacggtcatctccattgctcacatcgacagtttgaagatggagacagag
acttctgcacctggagaacaaccaaagtttctaggagtgagggaacaaagagtcactgga
acccttgtgtttattctgactggtctgtcagtctttatggctcccatcttgaagtttata
cccatgcctgtactctatggtgtgttcctgtatatgggagtagcatcccttaatggtgtg
cagttcatggatcgtctgaagctgcttctgatgcctctgaagcatcagcctgacttcatc
tacctgcgtcatgttcctctgcgcagagtccacctgttcactttcctgcaggtgttgtgt
ctggccctgctttggatcctcaagtcaacggtggctgctatcatttttccagtaatgatc
ttggcacttgtagctgtcagaaaaggcatggactacctcttctcccagcatgacctcagc
ttcctggatgatgtcattccagaaaaggacaagaaaaagaaggaggatgagaagaaaaag
aaaaagaagaagggaagtctggacagtgacaatgatgattctgactgcccatactcagaa
aaagttccaagtattaaaattccaatggacatcatggaacagcaacctttcctaagcgat
agcaaaccttctgacagagaaagatcaccaacattccttgaacgccacacatcatgctga

DBGET integrated database retrieval system