KEGG   Homo sapiens (human): 8671Help
Entry
8671              CDS       T01001                                 

Gene name
SLC4A4, HNBC1, KNBC, NBC1, NBC2, NBCe1-A, SLC4A5, hhNMC, pNBC
Definition
solute carrier family 4 (sodium bicarbonate cotransporter), member 4
Orthology
K13575  
solute carrier family 4 (sodium bicarbonate cotransporter), member 4
Organism
hsa  Homo sapiens (human)
Pathway
Proximal tubule bicarbonate reclamation
Pancreatic secretion
Bile secretion
Disease
H00429  
Proximal renal tubular acidosis (RTA type 2)
Class
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
Organismal Systems; Excretory system; Proximal tubule bicarbonate reclamation [PATH:hsa04964]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21
AA seq 1079 aa AA seqDB search
MEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRHKRKTGHKEKKEKERI
SENYSDKSDIENADESSSSILKPLISPAAERIRFILGEEDDSPAPPQLFTELDELLAVDG
QEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLP
QLVEMIVDHQIETGLLKPELKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTN
PDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDTPFI
AFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKA
KDRHDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTP
HDGGHGGGGHGDCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLAT
VTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLF
NFSKDNNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDA
FKKMIKLADYYPINSNFKVGYNTLFSCTCVPPDPANISISNDTTLAPEYLPTMSSTDMYH
NTTFDWAFLSKKECSKYGGNLVGNNCNFVPDITLMSFILFLGTYTSSMALKKFKTSPYFP
TTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPNRGWFVPPFGENPWWV
CLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVICSLMALPW
YVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFI
PMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLC
LALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKK
KKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTSC
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgaagctgtcctggacagaggggcttccttcctcaagcatgtgtgtgatgaa
gaagaagtagaaggccaccataccatttacatcggagtccatgtgccgaagagttacagg
agaaggagacgtcacaagagaaagacagggcacaaagaaaagaaggaaaaggagagaatc
tctgagaactactctgacaaatcagatattgaaaatgctgatgaatccagcagcagcatc
ctaaaacctctcatctctcctgctgcagaacgcatccgattcatcttgggagaggaggat
gacagcccagctccccctcagctcttcacggaactggatgagctgctggccgtggatggg
caggagatggagtggaaggaaacagccaggtggatcaagtttgaagaaaaagtggaacag
ggtggggaaagatggagcaagccccatgtggccacattgtcccttcatagtttatttgag
ctgaggacatgtatggagaaaggatccatcatgcttgatcgggaggcttcttctctccca
cagttggtggagatgattgttgaccatcagattgagacaggcctattgaaacctgaactt
aaggataaggtgacctatactttgctccggaagcaccggcatcaaaccaagaaatccaac
cttcggtccctggctgacattgggaagacagtctccagtgcaagtaggatgtttaccaac
cctgataatggtagcccagccatgacccataggaatctgacttcctccagtctgaatgac
atttctgataaaccggagaaggaccagctgaagaataagttcatgaaaaaattgccacgt
gatgcagaagcttccaacgtgcttgttggggaggttgactttttggatactcctttcatt
gcctttgttaggctacagcaggctgtcatgctgggtgccctgactgaagttcctgtgccc
acaaggttcttgttcattctcttaggtcctaaggggaaagccaagtcctaccacgagatt
ggcagagccattgccaccctgatgtctgatgaggtgttccatgacattgcttataaagca
aaagacaggcacgacctgattgctggtattgatgagttcctagatgaagtcatcgtcctt
ccacctggggaatgggatccagcaattaggatagagcctcctaagagtcttccatcctct
gacaaaagaaagaatatgtactcaggtggagagaatgttcagatgaatggggatacgccc
catgatggaggtcacggaggaggaggacatggggattgtgaagaattgcagcgaactgga
cggttctgtggtggactaattaaagacataaagaggaaagcgccattttttgccagtgat
ttttatgatgctttaaatattcaagctctttcggcaattctcttcatttatctggcaact
gtaactaatgctatcacttttggaggactgcttggggatgccactgacaacatgcagggc
gtgttggagagtttcctgggcactgctgtctctggagccatcttttgcctttttgctggt
caaccactcactattctgagcagcaccggacctgtcctagtttttgagaggcttctattt
aatttcagcaaggacaataattttgactatttggagtttcgcctttggattggcctgtgg
tccgccttcctatgtctcattttggtagccactgatgccagcttcttggttcaatacttc
acacgtttcacggaggagggcttttcctctctgattagcttcatctttatctatgatgct
ttcaagaagatgatcaagcttgcagattactaccccatcaactccaacttcaaagtgggc
tacaacactctcttttcctgtacctgtgtgccacctgacccagctaatatctcaatatct
aatgacaccacactggccccagagtatttgccaactatgtcttctactgacatgtaccat
aatactacctttgactgggcatttttgtcgaagaaggagtgttcaaaatacggaggaaac
ctcgtcgggaacaactgtaattttgttcctgatatcacactcatgtcttttatcctcttc
ttgggaacctacacctcttccatggctctgaaaaaattcaaaactagtccttattttcca
accacagcaagaaaactgatcagtgattttgccattatcttgtccattctcatcttttgt
gtaatagatgccctagtaggcgtggacaccccaaaactaattgtgccaagtgagttcaag
ccaacaagtccaaaccgaggttggttcgttccaccgtttggagaaaacccctggtgggtg
tgccttgctgctgctatcccggctttgttggtcactatactgattttcatggaccaacaa
attacagctgtgattgtaaacaggaaagaacataaactcaagaaaggagcagggtatcac
ttggatctcttttgggtggccatcctcatggttatatgctccctcatggctcttccgtgg
tatgtagctgctacggtcatctccattgctcacatcgacagtttgaagatggagacagag
acttctgcacctggagaacaaccaaagtttctaggagtgagggaacaaagagtcactgga
acccttgtgtttattctgactggtctgtcagtctttatggctcccatcttgaagtttata
cccatgcctgtactctatggtgtgttcctgtatatgggagtagcatcccttaatggtgtg
cagttcatggatcgtctgaagctgcttctgatgcctctgaagcatcagcctgacttcatc
tacctgcgtcatgttcctctgcgcagagtccacctgttcactttcctgcaggtgttgtgt
ctggccctgctttggatcctcaagtcaacggtggctgctatcatttttccagtaatgatc
ttggcacttgtagctgtcagaaaaggcatggactacctcttctcccagcatgacctcagc
ttcctggatgatgtcattccagaaaaggacaagaaaaagaaggaggatgagaagaaaaag
aaaaagaagaagggaagtctggacagtgacaatgatgattctgactgcccatactcagaa
aaagttccaagtattaaaattccaatggacatcatggaacagcaacctttcctaagcgat
agcaaaccttctgacagagaaagatcaccaacattccttgaacgccacacatcatgctga

DBGET integrated database retrieval system