KEGG   Homo sapiens (human): 8681Help
Entry
8681              CDS       T01001                                 

Gene name
JMJD7-PLA2G4B, HsT16992, cPLA2-beta
Definition
JMJD7-PLA2G4B readthrough
Orthology
K16342  
cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
MAPK signaling pathway
Ras signaling pathway
Vascular smooth muscle contraction
VEGF signaling pathway
Platelet activation
Fc epsilon RI signaling pathway
Glutamatergic synapse
Serotonergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Ovarian steroidogenesis
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    8681 (JMJD7-PLA2G4B)
   00565 Ether lipid metabolism
    8681 (JMJD7-PLA2G4B)
   00590 Arachidonic acid metabolism
    8681 (JMJD7-PLA2G4B)
   00591 Linoleic acid metabolism
    8681 (JMJD7-PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    8681 (JMJD7-PLA2G4B)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    8681 (JMJD7-PLA2G4B)
   04010 MAPK signaling pathway
    8681 (JMJD7-PLA2G4B)
   04370 VEGF signaling pathway
    8681 (JMJD7-PLA2G4B)
 Organismal Systems
  Immune system
   04611 Platelet activation
    8681 (JMJD7-PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    8681 (JMJD7-PLA2G4B)
  Endocrine system
   04912 GnRH signaling pathway
    8681 (JMJD7-PLA2G4B)
   04913 Ovarian Steroidogenesis
    8681 (JMJD7-PLA2G4B)
   04921 Oxytocin signaling pathway
    8681 (JMJD7-PLA2G4B)
  Circulatory system
   04270 Vascular smooth muscle contraction
    8681 (JMJD7-PLA2G4B)
  Nervous system
   04724 Glutamatergic synapse
    8681 (JMJD7-PLA2G4B)
   04726 Serotonergic synapse
    8681 (JMJD7-PLA2G4B)
   04730 Long-term depression
    8681 (JMJD7-PLA2G4B)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    8681 (JMJD7-PLA2G4B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     8681 (JMJD7-PLA2G4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q11.2-q21.3
AA seq 893 aa AA seqDB search
MAEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRPCIIRNALQH
WPALQKWSLPYFRATVGSTEVSVAVTPDGYADAVRGDRFMMPAERRLPLSFVLDVLEGRA
QHPGVLYVQKQCSNLPSELPQLLPDLESHVPWASEALGKMPDAVNFWLGEAAAVTSLHKD
HYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVDEEAMEKAEVSRT
CLLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVWNQSFHFRIH
RQLKNVMELKVFDQDLVTGDDPVLSVLFDAGTLRAGEFRRESFSLSPQGEGRLEVEFRLQ
SLADRGEWLVSNGVLVARELSCLHVQLEETGDQKSSEHRVQLVVPGSCEGPQEASVGTGT
FRFHCPACWEQELSIRLQDAPEEQLKAPLSALPSGQVVRLVFPTSQEPLMRVELKKEAGL
RELAVRLGFGPCAEEQAFLSRRKQVVAAALRQALQLDGDLQEDEIPVVAIMATGGGIRAM
TSLYGQLAGLKELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPTELLKTQVTKN
KLGVLAPSQLQRYRQELAERARLGYPSCFTNLWALINEALLHDEPHDHKLSDQREALSHG
QNPLPIYCALNTKGQSLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEFFMGQLMKRL
PESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWVRNQANLDKEQVPLLKIEEPPST
AGRIAEFFTDLLTWRPLAQATHNFLRGLHFHKDYFQHPHFSTWKATTLDGLPNQLTPSEP
HLCLLDVGYLINTSCLPLLQPTRDVDLILSLDYNLHGAFQGSGGHPRRRQLGR
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcggctttggaagccgtgcggagcgagttacgagaattcccggccgctgca
agggagctctgcgtgcctcttgctgtgccctacctggacaaacccccaactccgctccac
ttctaccgggactgggtctgccccaacaggccgtgcattatccgcaacgctctgcagcac
tggccggccctccagaagtggtccctcccctatttcagagccacagtgggctccacagag
gtgagtgtggccgtgaccccagatggttacgcggatgccgtgagaggggatcgcttcatg
atgccagctgagcgccgcctgcccctgagcttcgtgctggatgtgctggagggccgggcc
cagcaccctggagtcctctatgtgcagaagcagtgctccaacctgcccagcgagctgccc
cagctgctgcctgatctggaatcccatgtgccctgggcctccgaagccctgggaaagatg
cccgatgctgtgaacttctggctgggggaggcggctgcagtgacttctttgcacaaggac
cactatgagaacctctactgcgtggtctcaggagagaagcatttcctgttccatccgccc
agcgaccggcccttcatcccctatgagctgtacacgccggcaacctaccagctaactgaa
gagggcacctttaaggtggtggatgaagaggccatggagaaggcagaggtgtccaggacc
tgcctgctcacggttcgtgtcctgcaggcccatcgcctaccctctaaggacctagtgacc
ccctctgactgctacgtgactctctggctgcccacggcctgcagccacaggctccagaca
cgcacggtcaagaacagcagtagccctgtctggaaccagagctttcacttcaggatccac
aggcagctcaagaatgtcatggaactgaaagtctttgaccaggacctggtgaccggagat
gaccctgtgttgtcagtactgtttgatgcggggactctgcgggctggggagttccggcgc
gagagcttctcactgagccctcagggtgaggggcgcctggaagttgaatttcgcctgcag
agtctggctgaccgtggcgagtggctcgtcagcaatggcgttctggtggcccgggagctc
tcctgcttgcacgttcaactggaggagacaggagaccagaagtcctcagagcacagagtt
cagcttgtggttcctgggtcctgtgagggtccgcaggaggcctctgtgggcactggcacc
ttccgcttccactgcccagcctgctgggagcaggagctgagtattcgcctgcaggatgcc
cccgaggagcaactaaaggcgccactgagtgccctgccctctggtcaagtggtgaggctt
gtcttccccacgtcccaggagcccctgatgagagtggagctgaaaaaagaagcaggactg
agggagctggccgtgcgactgggcttcgggccctgtgcagaggagcaggccttcctgagc
aggaggaagcaggtggtggccgcggccttgaggcaggccctgcagctggacggagacctg
caggaggatgagatcccagtggtagctattatggccactggtggtgggatccgggcaatg
acttccctgtatgggcagctggctggcctgaaggagctgggcctcttggattgcgtctcc
tacatcaccggggcctcgggctccacctgggccttggccaacctttatgaggacccagag
tggtctcagaaggacctggcagggcccactgagttgctgaagacccaggtgaccaagaac
aagctgggtgtgctggcccccagccagctgcagcggtaccggcaggagctggccgagcgt
gcccgcttgggctacccaagctgcttcaccaacctgtgggccctcatcaacgaggcgctg
ctgcatgatgagccccatgatcacaagctctcagatcaacgggaggccctgagtcatggc
cagaaccctctgcccatctactgtgccctcaacaccaaagggcagagcctgaccactttt
gaatttggggagtggtgcgagttctctccctacgaggtcggcttccccaagtacggggcc
ttcatcccctctgagctctttggctccgagttctttatggggcagctgatgaagaggctt
cctgagtcccgcatctgcttcttagaaggtatctggagcaacctgtatgcagccaacctc
caggacagcttatactgggcctcagagcccagccagttctgggaccgctgggtcaggaac
caggccaacctggacaaggagcaggtcccccttctgaagatagaagaaccaccctcaaca
gccggcaggatagctgagtttttcaccgatcttctgacgtggcgtccactggcccaggcc
acacataatttcctgcgtggcctccatttccacaaagactactttcagcatcctcacttc
tccacatggaaagctaccactctggatgggctccccaaccagctgacaccctcggagccc
cacctgtgcctgctggatgttggctacctcatcaataccagctgcctgcccctcctgcag
cccactcgggacgtggacctcatcctgtcattggactacaacctccacggagccttccag
gggtccggcggacacccgaggaggcggcagctggggaggtga

DBGET integrated database retrieval system