KEGG   Homo sapiens (human): 8694Help
Entry
8694              CDS       T01001                                 

Gene name
DGAT1, ARAT, ARGP1, DGAT, DIAR7
Definition
diacylglycerol O-acyltransferase 1 (EC:2.3.1.20 2.3.1.76)
Orthology
K11155  
diacylglycerol O-acyltransferase 1 [EC:2.3.1.20 2.3.1.75 2.3.1.76]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Retinol metabolism
Metabolic pathways
Fat digestion and absorption
Module
Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    8694 (DGAT1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    8694 (DGAT1)
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    8694 (DGAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     8694 (DGAT1)
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     8694 (DGAT1)
    2.3.1.76  retinol O-fatty-acyltransferase
     8694 (DGAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
8q24.3
AA seq 488 aa AA seqDB search
MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVG
SGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQV
VSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPA
AVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHT
VSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM
VPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREF
YRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVS
VPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLN
YEAPAAEA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaccgcggcagctcccggcgccggaggacagggtcgcggccctcgagccacggc
ggcggcgggcctgcggcggcggaagaggaggtgcgggacgccgctgcgggccccgacgtg
ggagccgcgggggacgcgccagccccggcccccaacaaggacggagacgccggcgtgggc
agcggccactgggagctgaggtgccatcgcctgcaggattctttattcagctctgacagt
ggcttcagcaactaccgtggcatcctgaactggtgtgtggtgatgctgatcttgagcaat
gcccggttatttctggagaacctcatcaagtatggcatcctggtggaccccatccaggtg
gtttctctgttcctgaaggatccctatagctggcccgccccatgcctggttattgcggcc
aatgtctttgctgtggctgcattccaggttgagaagcgcctggcggtgggtgccctgacg
gagcaggcgggactgctgctgcacgtggccaacctggccaccattctgtgtttcccagcg
gctgtggtcttactggttgagtctatcactccagtgggctccctgctggcgctgatggcg
cacaccatcctcttcctcaagctcttctcctaccgcgacgtcaactcatggtgccgcagg
gccagggccaaggctgcctctgcagggaagaaggccagcagtgctgctgccccgcacacc
gtgagctacccggacaatctgacctaccgcgatctctactacttcctcttcgcccccacc
ttgtgctacgagctcaactttccccgctctccccgcatccggaagcgctttctgctgcga
cggatccttgagatgctgttcttcacccagctccaggtggggctgatccagcagtggatg
gtccccaccatccagaactccatgaagcccttcaaggacatggactactcacgcatcatc
gagcgcctcctgaagctggcggtccccaatcacctcatctggctcatcttcttctactgg
ctcttccactcctgcctgaatgccgtggctgagctcatgcagtttggagaccgggagttc
taccgggactggtggaactccgagtctgtcacctacttctggcagaactggaacatccct
gtgcacaagtggtgcatcagacacttctacaagcccatgcttcgacggggcagcagcaag
tggatggccaggacaggggtgttcctggcctcggccttcttccacgagtacctggtgagc
gtccctctgcgaatgttccgcctctgggcgttcacgggcatgatggctcagatcccactg
gcctggttcgtgggccgctttttccagggcaactatggcaacgcagctgtgtggctgtcg
ctcatcatcggacagccaatagccgtcctcatgtacgtccacgactactacgtgctcaac
tatgaggccccagcggcagaggcctga

DBGET integrated database retrieval system