KEGG   Homo sapiens (human): 87Help
Entry
87                CDS       T01001                                 

Gene name
ACTN1, BDPLT15
Definition
actinin, alpha 1
Orthology
K05699  
actinin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Adherens junction
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Amoebiasis
Viral carcinogenesis
Systemic lupus erythematosus
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:hsa05412]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q24; 14q22-q24
AA seq 892 aa AA seqDB search
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
DGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNV
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFC
ALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMT
YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENR
VPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRM
VSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQK
DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKIC
DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT
IEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI
NGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEM
HGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQL
LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGY
DIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDK
NYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggaccattatgattctcagcaaaccaacgattacatgcagccagaagaggactgggac
cgggacctgctcctggacccggcctgggagaagcagcagagaaagacattcacggcatgg
tgtaactcccacctccggaaggcggggacacagatcgagaacatcgaagaggacttccgg
gatggcctgaagctcatgctgctgctggaggtcatctcaggtgaacgcttggccaagcca
gagcgaggcaagatgagagtgcacaagatctccaacgtcaacaaggccctggatttcata
gccagcaaaggcgtcaaactggtgtccatcggagccgaagaaatcgtggatgggaatgtg
aagatgaccctgggcatgatctggaccatcatcctgcgctttgccatccaggacatctcc
gtggaagagacttcagccaaggaagggctgctcctgtggtgtcagagaaagacagcccct
tacaaaaatgtcaacatccagaacttccacataagctggaaggatggcctcggcttctgt
gctttgatccaccgacaccggcccgagctgattgactacgggaagctgcggaaggatgat
ccactcacaaatctgaatacggcttttgacgtggcagagaagtacctggacatccccaag
atgctggatgccgaagacatcgttggaactgcccgaccggatgagaaagccatcatgact
tacgtgtctagcttctaccacgccttctctggagcccagaaggcggagacagcagccaat
cgcatctgcaaggtgttggccgtcaaccaggagaacgagcagcttatggaagactacgag
aagctggccagtgatctgttggagtggatccgccgcacaatcccgtggctggagaaccgg
gtgcccgagaacaccatgcatgccatgcaacagaagctggaggacttccgggactaccgg
cgcctgcacaagccgcccaaggtgcaggagaagtgccagctggagatcaacttcaacacg
ctgcagaccaagctgcggctcagcaaccggcctgccttcatgccctctgagggcaggatg
gtctcggacatcaacaatgcctggggctgcctggagcaggtggagaagggctatgaggag
tggttgctgaatgagatccggaggctggagcgactggaccacctggcagagaagttccgg
cagaaggcctccatccacgaggcctggactgacggcaaagaggccatgctgcgacagaag
gactatgagaccgccaccctctcggagatcaaggccctgctcaagaagcatgaggccttc
gagagtgacctggctgcccaccaggaccgtgtggagcagattgccgccatcgcacaggag
ctcaatgagctggactattatgactcacccagtgtcaacgcccgttgccaaaagatctgt
gaccagtgggacaatctgggggccctaactcagaagcgaagggaagctctggagcggacc
gagaaactgctggagaccattgaccagctgtacttggagtatgccaagcgggctgcaccc
ttcaacaactggatggagggggccatggaggacctgcaggacaccttcattgtgcacacc
attgaggagatccagggactgaccacagcccatgagcagttcaaggccaccctccctgat
gccgacaaggagcgcctggccatcctgggcatccacaatgaggtgtccaagattgtccag
acctaccacgtcaatatggcgggcaccaacccctacacaaccatcacgcctcaggagatc
aatggcaaatgggaccacgtgcggcagctggtgcctcggagggaccaagctctgacggag
gagcatgcccgacagcagcacaatgagaggctacgcaagcagtttggagcccaggccaat
gtcatcgggccctggatccagaccaagatggaggagatcgggaggatctccattgagatg
catgggaccctggaggaccagctcagccacctgcggcagtatgagaagagcatcgtcaac
tacaagccaaagattgatcagctggagggcgaccaccagctcatccaggaggcgctcatc
ttcgacaacaagcacaccaactacaccatggagcacatccgtgtgggctgggagcagctg
ctcaccaccatcgccaggaccatcaatgaggtagagaaccagatcctgacccgggatgcc
aagggcatcagccaggagcagatgaatgagttccgggcctccttcaaccactttgaccgg
gatcactccggcacactgggtcccgaggagttcaaagcctgcctcatcagcttgggttat
gatattggcaacgacccccagggagaagcagaatttgcccgcatcatgagcattgtggac
cccaaccgcctgggggtagtgacattccaggccttcattgacttcatgtcccgcgagaca
gccgacacagatacagcagaccaagtcatggcttccttcaagatcctggctggggacaag
aactacattaccatggacgagctgcgccgcgagctgccacccgaccaggctgagtactgc
atcgcgcggatggccccctacaccggccccgactccgtgccaggtgctctggactacatg
tccttctccacggcgctgtacggcgagagtgacctctaa

DBGET integrated database retrieval system