KEGG   Homo sapiens (human): 87Help
Entry
87                CDS       T01001                                 

Gene name
ACTN1, BDPLT15
Definition
actinin, alpha 1
Orthology
K05699  
actinin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Adherens junction
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Amoebiasis
Viral carcinogenesis
Systemic lupus erythematosus
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    87 (ACTN1)
  Cellular commiunity
   04510 Focal adhesion
    87 (ACTN1)
   04520 Adherens junction
    87 (ACTN1)
   04530 Tight junction
    87 (ACTN1)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    87 (ACTN1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    87 (ACTN1)
  Immune diseases
   05322 Systemic lupus erythematosus
    87 (ACTN1)
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    87 (ACTN1)
  Infectious diseases
   05146 Amoebiasis
    87 (ACTN1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   87 (ACTN1)
  Exosomal proteins of colorectal cancer cells
   87 (ACTN1)
  Exosomal proteins of bladder cancer cells
   87 (ACTN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q24; 14q22-q24
AA seq 892 aa AA seqDB search
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
DGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNV
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFC
ALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMT
YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENR
VPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRM
VSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQK
DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKIC
DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT
IEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI
NGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEM
HGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQL
LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGY
DIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDK
NYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggaccattatgattctcagcaaaccaacgattacatgcagccagaagaggactgggac
cgggacctgctcctggacccggcctgggagaagcagcagagaaagacattcacggcatgg
tgtaactcccacctccggaaggcggggacacagatcgagaacatcgaagaggacttccgg
gatggcctgaagctcatgctgctgctggaggtcatctcaggtgaacgcttggccaagcca
gagcgaggcaagatgagagtgcacaagatctccaacgtcaacaaggccctggatttcata
gccagcaaaggcgtcaaactggtgtccatcggagccgaagaaatcgtggatgggaatgtg
aagatgaccctgggcatgatctggaccatcatcctgcgctttgccatccaggacatctcc
gtggaagagacttcagccaaggaagggctgctcctgtggtgtcagagaaagacagcccct
tacaaaaatgtcaacatccagaacttccacataagctggaaggatggcctcggcttctgt
gctttgatccaccgacaccggcccgagctgattgactacgggaagctgcggaaggatgat
ccactcacaaatctgaatacggcttttgacgtggcagagaagtacctggacatccccaag
atgctggatgccgaagacatcgttggaactgcccgaccggatgagaaagccatcatgact
tacgtgtctagcttctaccacgccttctctggagcccagaaggcggagacagcagccaat
cgcatctgcaaggtgttggccgtcaaccaggagaacgagcagcttatggaagactacgag
aagctggccagtgatctgttggagtggatccgccgcacaatcccgtggctggagaaccgg
gtgcccgagaacaccatgcatgccatgcaacagaagctggaggacttccgggactaccgg
cgcctgcacaagccgcccaaggtgcaggagaagtgccagctggagatcaacttcaacacg
ctgcagaccaagctgcggctcagcaaccggcctgccttcatgccctctgagggcaggatg
gtctcggacatcaacaatgcctggggctgcctggagcaggtggagaagggctatgaggag
tggttgctgaatgagatccggaggctggagcgactggaccacctggcagagaagttccgg
cagaaggcctccatccacgaggcctggactgacggcaaagaggccatgctgcgacagaag
gactatgagaccgccaccctctcggagatcaaggccctgctcaagaagcatgaggccttc
gagagtgacctggctgcccaccaggaccgtgtggagcagattgccgccatcgcacaggag
ctcaatgagctggactattatgactcacccagtgtcaacgcccgttgccaaaagatctgt
gaccagtgggacaatctgggggccctaactcagaagcgaagggaagctctggagcggacc
gagaaactgctggagaccattgaccagctgtacttggagtatgccaagcgggctgcaccc
ttcaacaactggatggagggggccatggaggacctgcaggacaccttcattgtgcacacc
attgaggagatccagggactgaccacagcccatgagcagttcaaggccaccctccctgat
gccgacaaggagcgcctggccatcctgggcatccacaatgaggtgtccaagattgtccag
acctaccacgtcaatatggcgggcaccaacccctacacaaccatcacgcctcaggagatc
aatggcaaatgggaccacgtgcggcagctggtgcctcggagggaccaagctctgacggag
gagcatgcccgacagcagcacaatgagaggctacgcaagcagtttggagcccaggccaat
gtcatcgggccctggatccagaccaagatggaggagatcgggaggatctccattgagatg
catgggaccctggaggaccagctcagccacctgcggcagtatgagaagagcatcgtcaac
tacaagccaaagattgatcagctggagggcgaccaccagctcatccaggaggcgctcatc
ttcgacaacaagcacaccaactacaccatggagcacatccgtgtgggctgggagcagctg
ctcaccaccatcgccaggaccatcaatgaggtagagaaccagatcctgacccgggatgcc
aagggcatcagccaggagcagatgaatgagttccgggcctccttcaaccactttgaccgg
gatcactccggcacactgggtcccgaggagttcaaagcctgcctcatcagcttgggttat
gatattggcaacgacccccagggagaagcagaatttgcccgcatcatgagcattgtggac
cccaaccgcctgggggtagtgacattccaggccttcattgacttcatgtcccgcgagaca
gccgacacagatacagcagaccaagtcatggcttccttcaagatcctggctggggacaag
aactacattaccatggacgagctgcgccgcgagctgccacccgaccaggctgagtactgc
atcgcgcggatggccccctacaccggccccgactccgtgccaggtgctctggactacatg
tccttctccacggcgctgtacggcgagagtgacctctaa

DBGET integrated database retrieval system