KEGG   Homo sapiens (human): 8706Help
Entry
8706              CDS       T01001                                 

Gene name
B3GALNT1, B3GALT3, GLCT3, GLOB, Gb4Cer, P, P1, beta3Gal-T3, galT3
Definition
beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group) (EC:2.4.1.79)
Orthology
K00719  
galactosylgalactosylglucosylceramide beta-D-acetylgalactosaminyltransferase [EC:2.4.1.79]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, globo-series, LacCer => Gb4Cer
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:hsa00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q25
AA seq 331 aa AA seqDB search
MASALWTVLPSRMSLRSLKWSLLLLSLLSFFVMWYLSLPHYNVIERVNWMYFYEYEPIYR
QDFHFTLREHSNCSHQNPFLVILVTSHPSDVKARQAIRVTWGEKKSWWGYEVLTFFLLGQ
EAEKEDKMLALSLEDEHLLYGDIIRQDFLDTYNNLTLKTIMAFRWVTEFCPNAKYVMKTD
TDVFINTGNLVKYLLNLNHSEKFFTGYPLIDNYSYRGFYQKTHISYQEYPFKVFPPYCSG
LGYIMSRDLVPRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC
QLRRVIAAHGFSSKEIITFWQVMLRNTTCHY
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggctctctggactgtccttccgagtaggatgtcactgagatccctcaaatgg
agcctcctgctgctgtcactcctgagtttctttgtgatgtggtacctcagccttccccac
tacaatgtgatagaacgcgtgaactggatgtacttctatgagtatgagccgatttacaga
caagactttcacttcacacttcgagagcattcaaactgctctcatcaaaatccatttctg
gtcattctggtgacctcccacccttcagatgtgaaagccaggcaggccattagagttact
tggggtgaaaaaaagtcttggtggggatatgaggttcttacatttttcttattaggccaa
gaggctgaaaaggaagacaaaatgttggcattgtccttagaggatgaacaccttctttat
ggtgacataatccgacaagattttttagacacatataataacctgaccttgaaaaccatt
atggcattcaggtgggtaactgagttttgccccaatgccaagtacgtaatgaagacagac
actgatgttttcatcaatactggcaatttagtgaagtatcttttaaacctaaaccactca
gagaagtttttcacaggttatcctctaattgataattattcctatagaggattttaccaa
aaaacccatatttcttaccaggagtatcctttcaaggtgttccctccatactgcagtggg
ttgggttatataatgtccagagatttggtgccaaggatctatgaaatgatgggtcacgta
aaacccatcaagtttgaagatgtttatgtcgggatctgtttgaatttattaaaagtgaac
attcatattccagaagacacaaatcttttctttctatatagaatccatttggatgtctgt
caactgagacgtgtgattgcagcccatggcttttcttccaaggagatcatcactttttgg
caggtcatgctaaggaacaccacatgccattattaa

DBGET integrated database retrieval system