KEGG   Homo sapiens (human): 8717Help
Entry
8717              CDS       T01001                                 

Gene name
TRADD, Hs.89862
Definition
(RefSeq) TNFRSF1A-associated via death domain
  KO
K03171  
tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Sphingolipid signaling pathway
Apoptosis
RIG-I-like receptor signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Tuberculosis
Hepatitis C
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    8717 (TRADD)
   04668 TNF signaling pathway
    8717 (TRADD)
   04071 Sphingolipid signaling pathway
    8717 (TRADD)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    8717 (TRADD)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    8717 (TRADD)
  Endocrine system
   04920 Adipocytokine signaling pathway
    8717 (TRADD)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    8717 (TRADD)
  Infectious diseases
   05152 Tuberculosis
    8717 (TRADD)
   05160 Hepatitis C
    8717 (TRADD)
   05169 Epstein-Barr virus infection
    8717 (TRADD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q22
AA seq 312 aa AA seqDB search
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPL
QPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRG
CRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLTDPNGGLA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgggcaaaatgggcacgaagagtgggtgggcagcgcatacctgtttgtggag
tcctcgctggacaaggtggtcctgtcggatgcctacgcgcacccccagcagaaggtggca
gtgtacagggctctgcaggctgccttggcagagagcggcgggagcccggacgtgctgcag
atgctgaagatccaccgcagcgacccgcagctgatcgtgcagctgcgattctgcgggcgg
cagccctgtggccgcttcctccgcgcctaccgcgagggggcgctgcgcgccgcgctgcag
aggagcctggcggccgcgctcgcccagcactcggtgccgctgcaactggagctgcgcgcc
ggcgccgagcggctggacgctttgctggcggacgaggagcgctgtttgagttgcatccta
gcccagcagcccgaccggctccgggatgaagaactggctgagctggaggatgcgctgcga
aatctgaagtgcggctcgggggcccggggtggcgacggggaggtcgcttcggcccccttg
cagcccccggtgccctctctgtcggaggtgaagccgccgccgccgccgccacctgcccag
acttttctgttccagggtcagcctgtagtgaatcggccgctgagcctgaaggaccaacag
acgttcgcgcgctctgtgggtctcaaatggcgcaaggtggggcgctcactgcagcgaggc
tgccgggcgctgcgggacccggcgctggactcgctggcctacgagtacgagcgcgaggga
ctgtacgagcaggccttccagctgctgcggcgcttcgtgcaggccgagggccgccgcgcc
acgctgcagcgcctggtggaggcactcgaggagaacgagctcaccagcctggcagaggac
ttgctgggcctgaccgatcccaatggcggcctggcctag

DBGET integrated database retrieval system