KEGG   Homo sapiens (human): 8717Help
Entry
8717              CDS       T01001                                 

Gene name
TRADD, Hs.89862
Definition
TNFRSF1A-associated via death domain
Orthology
K03171  
tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Apoptosis
RIG-I-like receptor signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Tuberculosis
Hepatitis C
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    8717 (TRADD)
   04668 TNF signaling pathway
    8717 (TRADD)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    8717 (TRADD)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    8717 (TRADD)
  Endocrine system
   04920 Adipocytokine signaling pathway
    8717 (TRADD)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    8717 (TRADD)
  Infectious diseases
   05152 Tuberculosis
    8717 (TRADD)
   05160 Hepatitis C
    8717 (TRADD)
   05169 Epstein-Barr virus infection
    8717 (TRADD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q22
AA seq 312 aa AA seqDB search
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPL
QPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRG
CRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLTDPNGGLA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgggcaaaatgggcacgaagagtgggtgggcagcgcatacctgtttgtggag
tcctcgctggacaaggtggtcctgtcggatgcctacgcgcacccccagcagaaggtggca
gtgtacagggctctgcaggctgccttggcagagagcggcgggagcccggacgtgctgcag
atgctgaagatccaccgcagcgacccgcagctgatcgtgcagctgcgattctgcgggcgg
cagccctgtggccgcttcctccgcgcctaccgcgagggggcgctgcgcgccgcgctgcag
aggagcctggcggccgcgctcgcccagcactcggtgccgctgcaactggagctgcgcgcc
ggcgccgagcggctggacgctttgctggcggacgaggagcgctgtttgagttgcatccta
gcccagcagcccgaccggctccgggatgaagaactggctgagctggaggatgcgctgcga
aatctgaagtgcggctcgggggcccggggtggcgacggggaggtcgcttcggcccccttg
cagcccccggtgccctctctgtcggaggtgaagccgccgccgccgccgccacctgcccag
acttttctgttccagggtcagcctgtagtgaatcggccgctgagcctgaaggaccaacag
acgttcgcgcgctctgtgggtctcaaatggcgcaaggtggggcgctcactgcagcgaggc
tgccgggcgctgcgggacccggcgctggactcgctggcctacgagtacgagcgcgaggga
ctgtacgagcaggccttccagctgctgcggcgcttcgtgcaggccgagggccgccgcgcc
acgctgcagcgcctggtggaggcactcgaggagaacgagctcaccagcctggcagaggac
ttgctgggcctgaccgatcccaatggcggcctggcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system