KEGG   Homo sapiens (human): 8717Help
Entry
8717              CDS       T01001                                 

Gene name
TRADD, Hs.89862
Definition
TNFRSF1A-associated via death domain
Orthology
K03171  
tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Apoptosis
RIG-I-like receptor signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Tuberculosis
Hepatitis C
Epstein-Barr virus infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q22
AA seq 312 aa AA seqDB search
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPL
QPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRG
CRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLTDPNGGLA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgggcaaaatgggcacgaagagtgggtgggcagcgcatacctgtttgtggag
tcctcgctggacaaggtggtcctgtcggatgcctacgcgcacccccagcagaaggtggca
gtgtacagggctctgcaggctgccttggcagagagcggcgggagcccggacgtgctgcag
atgctgaagatccaccgcagcgacccgcagctgatcgtgcagctgcgattctgcgggcgg
cagccctgtggccgcttcctccgcgcctaccgcgagggggcgctgcgcgccgcgctgcag
aggagcctggcggccgcgctcgcccagcactcggtgccgctgcaactggagctgcgcgcc
ggcgccgagcggctggacgctttgctggcggacgaggagcgctgtttgagttgcatccta
gcccagcagcccgaccggctccgggatgaagaactggctgagctggaggatgcgctgcga
aatctgaagtgcggctcgggggcccggggtggcgacggggaggtcgcttcggcccccttg
cagcccccggtgccctctctgtcggaggtgaagccgccgccgccgccgccacctgcccag
acttttctgttccagggtcagcctgtagtgaatcggccgctgagcctgaaggaccaacag
acgttcgcgcgctctgtgggtctcaaatggcgcaaggtggggcgctcactgcagcgaggc
tgccgggcgctgcgggacccggcgctggactcgctggcctacgagtacgagcgcgaggga
ctgtacgagcaggccttccagctgctgcggcgcttcgtgcaggccgagggccgccgcgcc
acgctgcagcgcctggtggaggcactcgaggagaacgagctcaccagcctggcagaggac
ttgctgggcctgaccgatcccaatggcggcctggcctag

DBGET integrated database retrieval system