KEGG   Homo sapiens (human): 8735Help
Entry
8735              CDS       T01001                                 

Gene name
MYH13, MyHC-IIL, MyHC-eo
Definition
myosin, heavy chain 13, skeletal muscle
Orthology
K10352  
myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    8735 (MYH13)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   8735 (MYH13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13
AA seq 1938 aa AA seqDB search
MSSDAEMAIFGEAAPYLRKPEKERIEAQNRPFDSKKACFVADNKEMYVKGMIQTRENDKV
IVKTLDDRMLTLNNDQVFPMNPPKFDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSG
LFCVTVNPYKWLPVYKPEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRDNQSILITGE
SGAGKTVNTKRVIQYFATIAVTGDKKKETQPGKMQGTLEDQIIQANPLLEAFGNAKTVRN
DNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLSSERSYHIFYQIMSNKKPELI
DLLLISTNPFDFPFVSQGEVTVASIDDSEELLATDNAIDILGFSSEEKVGIYKLTGAVMH
YGNMKFKQKQREEQAEPDGTEVADKAGYLMGLNSAEMLKGLCCPRVKVGNEYVTKGQNVQ
QVTNSVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCI
NFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEEC
MFPKATDTSFKNKLYDQHLGKSNNFQKPKPAKGKAEAHFSLVHYAGTVDYNIAGWLDKNK
DPLNETVVGLYQKSSLKLLSFLFSNYAGAETGDSGGSKKGGKKKGSSFQTVSAVFRENLN
KLMTNLRSTHPHFVRCLIPNETKTPGVMDHYLVMHQLRCNGVLEGIRICRKGFPSRILYA
DFKQRYRILNASAIPEGQFIDSKNASEKLLNSIDVDREQFRFGNTKVFFKAGLLGLLEEM
RDEKLVTLMTSTQAVCRGYLMRVEFKKMMERRDSIFCIQYNIRSFMNVKHWPWMNLFFKI
KPLLKSAEAEKEMATMKEDFERTKEELARSEARRKELEEKMVSLLQEKNDLQLQVQSETE
NLMDAEERCEGLIKSKILLEAKVKELTERLEEEEEMNSELVAKKRNLEDKCSSLKRDIDD
LELTLTKVEKEKHATENKVKNLSEEMTALEENISKLTKEKKSLQEAHQQTLDDLQVEEDK
VNGLIKINAKLEQQTDDLEGSLEQEKKLRADLERAKRKLEGDLKMSQESIMDLENDKQQI
EEKLKKKEFELSQLQAKIDDEQVHSLQFQKKIKELQARIEELEEEIEAEHTLRAKIEKQR
SDLARELEEISERLEEASGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKQ
ADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDMASNIEALSKSKSNIERTCRTVEDQF
SEIKAKDEQQTQLIHDLNMQKARLQTQNGELSHRVEEKESLISQLTKSKQALTQQLEELK
RQMEEETKAKNAMAHALQSSRHDCDLLREQYEEEQEAKAELQRALSKANSEVAQWRTKYE
TDAIQRTEELEEAKKKLAQRLQEAEENTETANSKCASLEKTKQRLQGEVEDLMRDLERSH
TACATLDKKQRNFDKVLAEWKQKLDESQAELEAAQKESRSLSTELFKMRNAYEEVVDQLE
TLRRENKNLQEEISDLTEQIAETGKNLQEAEKTKKLVEQEKSDLQVALEEVEGSLEHEES
KILRVQLELSQVKSELDRKVIEKDEEIEQLKRNSQRAAEALQSVLDAEIRSRNDALRLKK
KMEGDLNEMEIQLGHSNRQMAETQKHLRTVQGQLKDSQLHLDDALRSNEDLKEQLAIVER
RNGLLLEELEEMKVALEQTERTRRLSEQELLDASDRVQLLHSQNTSLINTKKKLEADIAQ
CQAEVENSIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHR
LDEAEQLALKGGKKQIQKLENRVRELENELDVEQKRGAEALKGAHKYERKVKEMTYQAEE
DHKNILRLQDLVDKLQAKVKSYKRQAEEAEEQANTQLSRCRRVQHELEEAAERADIAESQ
VNKLRAKSRDVGSQKMEE
NT seq 5817 nt NT seq  +upstreamnt  +downstreamnt
atgagctctgacgcagaaatggccatttttggagaagcagctccctacctccggaaacca
gagaaggagagaatcgaggctcaaaatcgtccattcgattccaagaaagcctgctttgta
gcggataataaggaaatgtatgtgaaaggcatgatccagactagggaaaatgacaaagtc
atagtcaagaccctcgatgaccggatgctcactctgaacaatgaccaggtcttccccatg
aaccctcccaaatttgacaagatcgaggacatggccatgatgactcacctgcatgaacct
gctgttctgtacaacctcaaagagcgctatgcagcctggatgatctacacctactcaggc
ctcttctgtgtcaccgtcaacccctacaagtggctgccggtgtacaagcccgaggtggtg
gctgcctacagaggcaaaaagcgccaggaggccccgccccacatcttctccatctctgac
aatgcctatcagttcatgctgactgatcgagacaaccagtctatcctcatcaccggagaa
tccggggctgggaagactgtgaacaccaagcgtgtcatccagtattttgcaacaattgca
gttaccggggacaagaagaaggagacacagccaggcaaaatgcagggaaccctagaggat
cagatcatccaggccaacccactgctggaggcctttggaaatgccaagactgtgaggaat
gacaactcctcaagatttgggaagttcattcggattcattttggagccacaggaaagctg
gcatcggcagacatcgaaacttatctgttagaaaaatccagagtgacgtttcaattatcc
agtgagagaagctatcatattttctaccaaattatgtcaaacaagaagccagaactaatt
gacctgcttctgatctccaccaaccccttcgacttccccttcgtgagccaaggagaggtc
acggtagccagtatcgatgacagtgaagaactgctggcgacagataatgccattgacatc
ctgggcttcagctcagaggagaaagtcgggatctacaaactgacgggagccgtgatgcat
tatgggaacatgaagttcaagcagaagcagcgtgaggagcaggcggagccagacggcacc
gaagtggctgacaaagccggatacctgatgggactgaattctgcagaaatgctgaagggc
ctgtgctgtccaagggtgaaggttggcaatgaatatgtcactaaagggcaaaatgtccag
caggtgaccaattcggtgggtgctctggccaaagccgtctacgagaagatgttcctgtgg
atggtcacccgcatcaaccagcagctggacaccaagcagcccaggcagtacttcatcggg
gtcttggacattgctggctttgagatctttgatttcaacagcctggagcagctgtgcatc
aacttcaccaatgagaaactgcaacagtttttcaaccaccacatgttcgtgctggagcag
gaagagtacaagaaggaaggcatcgagtgggagttcattgacttcggaatggacctggct
gcctgcatcgagctcatcgagaagcctatgggcatcttctccatcctggaagaggagtgc
atgttccccaaggcaacagacacctccttcaagaacaagctgtatgaccagcatcttgga
aaatccaacaacttccagaagcccaagcctgccaaaggcaaggctgaggctcacttctcg
ctggtgcactatgccggcaccgtggactacaacatcgccggctggctggacaaaaacaag
gaccccctgaacgagactgtggtggggctgtaccagaagtcttcgctgaagcttctctcc
ttccttttttccaactatgctggtgcagagacaggcgactccggaggaagcaagaagggc
gggaagaagaagggctcctctttccagaccgtgtcggccgtgttcagggaaaatttaaac
aaattgatgactaacttaaggagcacccaccctcactttgtacgatgtctgattcccaat
gagaccaagactcctggtgtgatggaccactacttggtcatgcaccagctgcgctgtaac
ggggtcctcgagggcatccggatttgcaggaagggattccccagccggatcctctatgct
gacttcaagcagcggtaccggatcctcaatgccagtgctatccctgaagggcagttcatt
gacagcaaaaatgcctcagagaagctcctcaactccatcgatgtggaccgggagcagttc
aggttcggcaacaccaaggtgtttttcaaagctgggctcctgggacttttggaggagatg
agagatgagaagctggtgacgctgatgacaagcacgcaggcggtgtgcagggggtacctg
atgcgggtggagttcaagaagatgatggagaggagggactccatcttctgcatccagtac
aacatccgctcttttatgaacgtcaagcactggccctggatgaacctgttcttcaaaatc
aagcccctgctgaagagtgcagaggccgagaaggagatggccaccatgaaggaagacttt
gagaggaccaaggaagaactggcccgatctgaggctcgccggaaggagctggaggagaaa
atggtctccctcctgcaggagaagaatgacctccaattgcaggtccagtctgaaacagaa
aatctgatggacgctgaggaacggtgtgaaggactcatcaaaagcaagatcctactggaa
gcaaaagtcaaggagctgacggagagattggaagaggaagaggagatgaattctgaattg
gttgccaagaagaggaatctggaagataaatgctcctctctcaagagagacattgatgac
ctggagctgaccttgacgaaagttgaaaaggagaagcatgccacagagaacaaggtaaag
aatctttccgaagaaatgacagcacttgaagaaaacatttccaaattgaccaaagaaaag
aaatctctacaggaggcccatcagcaaacactggatgatcttcaggtggaagaagataaa
gtcaatggtctaatcaaaataaatgccaagcttgaacagcaaacagatgatcttgagggt
tccttagagcaggagaagaaactgcgggcggacttggaaagggcgaagaggaagctggaa
ggagatctgaaaatgtcccaggaatccattatggatctagaaaatgacaagcagcaaata
gaagagaaattgaaaaagaaggagtttgaactcagtcagttacaagccaaaatagatgac
gaacaagtccacagtttgcagtttcaaaagaagattaaagaactgcaagcccgcatagaa
gagctggaggaggaaattgaagcggaacacacgctcagagccaagattgagaagcagcgc
tcagatctggccagggaactggaggagatcagcgagaggctggaagaagccagtggggcc
acttcagcccagattgagatgaacaagaagagggaggctgagttccagaaaatgcgcagg
gacctggaggaggccaccctgcagcacgaagccacagcagccaccctgaggaagaagcaa
gcagatagtgtggccgagcttggggagcagattgacaacctgcagcgggtgaagcagaag
ctggagaaggagaagagcgagctgaagatggagattgacgacatggccagcaacatcgag
gctctctccaagtcaaagagtaacatagaaagaacgtgccggacggtagaagatcaattt
agtgaaatcaaagccaaggacgagcaacagacacagttgatccatgatctgaacatgcag
aaagcaagactgcagacccaaaatggggagctgagccaccgagtggaagagaaggagtct
ctgatttcacagctgaccaaaagcaagcaggccctcacccagcagctggaggagcttaag
aggcaaatggaagaagaaaccaaggccaagaacgccatggcgcacgccctgcagtcctcc
cgccacgactgtgacctgctgcgggaacagtatgaggaggagcaggaagccaaggccgag
ctgcagagggcgctgtccaaggccaacagtgaggttgcccagtggaggaccaaatacgag
acggacgccattcagcgcacagaggagctggaggaggccaagaaaaaactggcccagagg
ctccaggaagcagaggagaacacggagacggcgaactccaagtgcgcatcgttggagaaa
accaagcagaggctgcagggagaggtggaggatctgatgcgggatctggagcgctcccac
accgcctgtgccacactggacaagaagcagaggaacttcgacaaggtccttgcagagtgg
aagcaaaagctggacgaaagccaggctgagttggaagctgctcagaaggagtccaggtca
ctcagcactgaactcttcaagatgaggaatgcctatgaggaggtggtggaccagttagag
acactgaggcgagagaacaaaaatctgcaagaagagatttccgacttaactgagcagatt
gcagaaactggcaagaatcttcaggaagcggaaaagaccaagaagctagtggagcaggaa
aagtcagatctgcaggtcgccttagaagaagtggagggttccttggaacacgaggagagc
aagatcttgcgcgtgcagctagagctgagccaggtgaaatccgagctagaccgcaaggtc
attgagaaggatgaagaaatcgagcagctaaaaagaaacagccagcgggcagcagaggcc
ctgcagagcgtgctggatgctgaaatccgcagccggaacgacgccctgaggctaaagaag
aagatggagggagaccttaatgagatggagattcagctgggccactccaaccgccagatg
gcagagacccagaagcatctgcgcacggtccagggccagctcaaggactcccagctgcat
ctcgatgacgccctgaggagcaatgaggacctcaaggagcagctggccatcgtggagcgc
aggaatggcctcctgctggaggagctggaggaaatgaaggtggccctggaacagacggag
cggacccgcaggctgtcagagcaggagctgctggacgccagcgaccgcgtgcagctcctg
cactcccagaacacaagcctgataaataccaagaaaaaactggaggctgacatagctcag
tgccaggcagaggtggagaactcgatccaggagtccaggaacgcagaggagaaggccaag
aaggccatcacggatgctgccatgatggctgaggagctaaagaaggaacaggacaccagc
gcccacctggagcggatgaagaagaacctggagcagacggtgaaggacctgcagcaccgt
ctagatgaggctgaacaactggcgctgaagggcgggaagaagcagatccagaaactggag
aaccgggtgcgggagctggaaaatgagcttgatgtggaacagaagaggggagctgaagcc
ctgaagggagcccacaagtacgaacgcaaagtcaaggagatgacttaccaggctgaggag
gaccacaagaatatccttaggctccaggacctggtggacaagctgcaggccaaagtgaag
tcttacaagaggcaggctgaggaggcggaggagcaggccaacacgcagctgtccagatgc
cggagagtccagcatgagctagaggaggccgcggagagggcggacatcgctgagtcccag
gtcaacaagctgagggccaagagccgagacgtgggcagccagaagatggaagaatga

DBGET integrated database retrieval system