KEGG   Homo sapiens (human): 8740Help
Entry
8740              CDS       T01001                                 

Gene name
TNFSF14, CD258, HVEML, LIGHT, LTg, TR2
Definition
tumor necrosis factor (ligand) superfamily, member 14
Orthology
K05477  
tumor necrosis factor ligand superfamily member 14
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Herpes simplex infection
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 240 aa AA seqDB search
MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQ
LHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGL
AFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELL
VSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggaggagagtgtcgtacggccctcagtgtttgtggtggatggacagaccgacatccca
ttcacgaggctgggacgaagccaccggagacagtcgtgcagtgtggcccgggtgggtctg
ggtctcttgctgttgctgatgggggccgggctggccgtccaaggctggttcctcctgcag
ctgcactggcgtctaggagagatggtcacccgcctgcctgacggacctgcaggctcctgg
gagcagctgatacaagagcgaaggtctcacgaggtcaacccagcagcgcatctcacaggg
gccaactccagcttgaccggcagcggggggccgctgttatgggagactcagctgggcctg
gccttcctgaggggcctcagctaccacgatggggcccttgtggtcaccaaagctggctac
tactacatctactccaaggtgcagctgggcggtgtgggctgcccgctgggcctggccagc
accatcacccacggcctctacaagcgcacaccccgctaccccgaggagctggagctgttg
gtcagccagcagtcaccctgcggacgggccaccagcagctcccgggtctggtgggacagc
agcttcctgggtggtgtggtacacctggaggctggggagaaggtggtcgtccgtgtgctg
gatgaacgcctggttcgactgcgtgatggtacccggtcttacttcggggctttcatggtg
tga

DBGET integrated database retrieval system