KEGG   Homo sapiens (human): 8740Help
Entry
8740              CDS       T01001                                 

Gene name
TNFSF14, CD258, HVEML, LIGHT, LTg, TR2
Definition
tumor necrosis factor (ligand) superfamily, member 14
Orthology
K05477  
tumor necrosis factor ligand superfamily member 14
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    8740 (TNFSF14)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8740 (TNFSF14)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    8740 (TNFSF14)
Cellular antigens [BR:hsa04090]
 Proteins
  8740 (TNFSF14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 240 aa AA seqDB search
MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQ
LHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGL
AFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELL
VSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggaggagagtgtcgtacggccctcagtgtttgtggtggatggacagaccgacatccca
ttcacgaggctgggacgaagccaccggagacagtcgtgcagtgtggcccgggtgggtctg
ggtctcttgctgttgctgatgggggccgggctggccgtccaaggctggttcctcctgcag
ctgcactggcgtctaggagagatggtcacccgcctgcctgacggacctgcaggctcctgg
gagcagctgatacaagagcgaaggtctcacgaggtcaacccagcagcgcatctcacaggg
gccaactccagcttgaccggcagcggggggccgctgttatgggagactcagctgggcctg
gccttcctgaggggcctcagctaccacgatggggcccttgtggtcaccaaagctggctac
tactacatctactccaaggtgcagctgggcggtgtgggctgcccgctgggcctggccagc
accatcacccacggcctctacaagcgcacaccccgctaccccgaggagctggagctgttg
gtcagccagcagtcaccctgcggacgggccaccagcagctcccgggtctggtgggacagc
agcttcctgggtggtgtggtacacctggaggctggggagaaggtggtcgtccgtgtgctg
gatgaacgcctggttcgactgcgtgatggtacccggtcttacttcggggctttcatggtg
tga

DBGET integrated database retrieval system