KEGG   Homo sapiens (human): 8743Help
Entry
8743              CDS       T01001                                 

Gene name
TNFSF10, APO2L, Apo-2L, CD253, TL2, TRAIL
Definition
tumor necrosis factor (ligand) superfamily, member 10
Orthology
K04721  
tumor necrosis factor ligand superfamily member 10
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Measles
Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    8743 (TNFSF10)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8743 (TNFSF10)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    8743 (TNFSF10)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    8743 (TNFSF10)
 Human Diseases
  Infectious diseases
   05162 Measles
    8743 (TNFSF10)
   05164 Influenza A
    8743 (TNFSF10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   8743 (TNFSF10)
Cellular antigens [BR:hsa04090]
 Proteins
  8743 (TNFSF10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q26
AA seq 101 aa AA seqDB search
MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACFLKE
DDSYWDPNDEESMNSPCWQVKWQLRQLVRKTPRMKRLWAAK
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggctatgatggaggtccaggggggacccagcctgggacagacctgcgtgctgatcgtg
atcttcacagtgctcctgcagtctctctgtgtggctgtaacttacgtgtactttaccaac
gagctgaagcagatgcaggacaagtactccaaaagtggcattgcttgtttcttaaaagaa
gatgacagttattgggaccccaatgacgaagagagtatgaacagcccctgctggcaagtc
aagtggcaactccgtcagctcgttagaaagactccaagaatgaaaaggctctgggccgca
aaataa

DBGET integrated database retrieval system