KEGG   Homo sapiens (human): 8743Help
Entry
8743              CDS       T01001                                 

Gene name
TNFSF10, APO2L, Apo-2L, CD253, TL2, TRAIL
Definition
tumor necrosis factor (ligand) superfamily, member 10
Orthology
K04721  
tumor necrosis factor ligand superfamily member 10
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Measles
Influenza A
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q26
AA seq 101 aa AA seqDB search
MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACFLKE
DDSYWDPNDEESMNSPCWQVKWQLRQLVRKTPRMKRLWAAK
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggctatgatggaggtccaggggggacccagcctgggacagacctgcgtgctgatcgtg
atcttcacagtgctcctgcagtctctctgtgtggctgtaacttacgtgtactttaccaac
gagctgaagcagatgcaggacaagtactccaaaagtggcattgcttgtttcttaaaagaa
gatgacagttattgggaccccaatgacgaagagagtatgaacagcccctgctggcaagtc
aagtggcaactccgtcagctcgttagaaagactccaagaatgaaaaggctctgggccgca
aaataa

DBGET integrated database retrieval system