KEGG   Homo sapiens (human): 8766Help
Entry
8766              CDS       T01001                                 

Gene name
RAB11A, YL8
Definition
RAB11A, member RAS oncogene family
Orthology
K07904  
Ras-related protein Rab-11A
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    8766 (RAB11A)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    8766 (RAB11A)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    8766 (RAB11A)
   04961 Endocrine and other factor-regulated calcium reabsorption
    8766 (RAB11A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8766 (RAB11A)
  Exosomal proteins of colorectal cancer cells
   8766 (RAB11A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    8766 (RAB11A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q22.31
AA seq 155 aa AA seqDB search
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNEANVRQTRK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgggcacccgcgacgacgagtacgactacctctttaaagttgtccttattggagattct
ggtgttggaaagagtaatctcctgtctcgatttactcgaaatgagtttaatctggaaagc
aagagcaccattggagtagagtttgcaacaagaagcatccaggttgatggaaaaacaata
aaggcacagatatgggacacagcagggcaagagcgatatcgagctataacatcagcatat
tatcgtggagctgtaggtgccttattggtttatgacattgctaaacatctcacatatgaa
aatgtagagcgatggctgaaagaactgagagatcatgctgatagtaacattgttatcatg
cttgtgggcaataagagtgatctacgtcatctcagggcagttcctacagatgaagcaaga
gcttttgcagaaaagaatgaagcaaatgtcagacagacgcgaaaatga

DBGET integrated database retrieval system