KEGG   Homo sapiens (human): 8766Help
Entry
8766              CDS       T01001                                 

Gene name
RAB11A, YL8
Definition
RAB11A, member RAS oncogene family
Orthology
K07904  
Ras-related protein Rab-11A
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Pancreatic secretion
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Excretory system; Vasopressin-regulated water reabsorption [PATH:hsa04962]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:hsa04961]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q22.31
AA seq 155 aa AA seqDB search
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNEANVRQTRK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgggcacccgcgacgacgagtacgactacctctttaaagttgtccttattggagattct
ggtgttggaaagagtaatctcctgtctcgatttactcgaaatgagtttaatctggaaagc
aagagcaccattggagtagagtttgcaacaagaagcatccaggttgatggaaaaacaata
aaggcacagatatgggacacagcagggcaagagcgatatcgagctataacatcagcatat
tatcgtggagctgtaggtgccttattggtttatgacattgctaaacatctcacatatgaa
aatgtagagcgatggctgaaagaactgagagatcatgctgatagtaacattgttatcatg
cttgtgggcaataagagtgatctacgtcatctcagggcagttcctacagatgaagcaaga
gcttttgcagaaaagaatgaagcaaatgtcagacagacgcgaaaatga

DBGET integrated database retrieval system