KEGG   Homo sapiens (human): 8793Help
Entry
8793              CDS       T01001                                 

Gene name
TNFRSF10D, CD264, DCR2, TRAIL-R4, TRAILR4, TRUNDD
Definition
(RefSeq) TNF receptor superfamily member 10d
  KO
K04722  tumor necrosis factor receptor superfamily member 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04650  Natural killer cell mediated cytotoxicity
hsa05162  Measles
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8793 (TNFRSF10D)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    8793 (TNFRSF10D)
   04217 Necroptosis
    8793 (TNFRSF10D)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    8793 (TNFRSF10D)
 Human Diseases
  Infectious diseases
   05162 Measles
    8793 (TNFRSF10D)
   05164 Influenza A
    8793 (TNFRSF10D)
Cytokine receptors [BR:hsa04050]
 TNF receptor family
  8793 (TNFRSF10D)
CD molecules [BR:hsa04090]
 Proteins
  8793 (TNFRSF10D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 ECSCR ODV-E18 ASFV_J13L
Motif
Other DBs
NCBI-GeneID: 8793
NCBI-ProteinID: NP_003831
OMIM: 603614
HGNC: 11907
Ensembl: ENSG00000173530
Vega: OTTHUMG00000097845
Pharos: Q9UBN6(Tbio)
UniProt: Q9UBN6
Position
8p21.3
AA seq 386 aa AA seqDB search
MGLWGQSVPTASSARAGRYPGARTASGTRPWLLDPKILKFVVFIVAVLLPVRVDSATIPR
QDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTV
CKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKC
KNESAASSTGKTPAAEETVTTILGMLASPYHYLIIIVVLVIILAVVVVGFSCRKKFISYL
KGICSGGGGGPERVHRVLFRRRSCPSRVPGAEDNARNETLSNRYLQPTQVSEQEIQGQEL
AELTGVTVELPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKE
TIQDQLVGSEKLFYEEDEAGSATSCL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgggactttggggacaaagcgtcccgaccgcctcgagcgctcgagcagggcgctatcca
ggagccaggacagcgtcgggaaccagaccatggctcctggaccccaagatccttaagttc
gtcgtcttcatcgtcgcggttctgctgccggtccgggttgactctgccaccatcccccgg
caggacgaagttccccagcagacagtggccccacagcaacagaggcgcagcctcaaggag
gaggagtgtccagcaggatctcatagatcagaatatactggagcctgtaacccgtgcaca
gagggtgtggattacaccattgcttccaacaatttgccttcttgcctgctatgtacagtt
tgtaaatcaggtcaaacaaataaaagttcctgtaccacgaccagagacaccgtgtgtcag
tgtgaaaaaggaagcttccaggataaaaactcccctgagatgtgccggacgtgtagaaca
gggtgtcccagagggatggtcaaggtcagtaattgtacgccccggagtgacatcaagtgc
aaaaatgaatcagctgccagttccactgggaaaaccccagcagcggaggagacagtgacc
accatcctggggatgcttgcctctccctatcactaccttatcatcatagtggttttagtc
atcattttagctgtggttgtggttggcttttcatgtcggaagaaattcatttcttacctc
aaaggcatctgctcaggtggtggaggaggtcccgaacgtgtgcacagagtccttttccgg
cggcgttcatgtccttcacgagttcctggggcggaggacaatgcccgcaacgagaccctg
agtaacagatacttgcagcccacccaggtctctgagcaggaaatccaaggtcaggagctg
gcagagctaacaggtgtgactgtagagttgccagaggagccacagcgtctgctggaacag
gcagaagctgaagggtgtcagaggaggaggctgctggttccagtgaatgacgctgactcc
gctgacatcagcaccttgctggatgcctcggcaacactggaagaaggacatgcaaaggaa
acaattcaggaccaactggtgggctccgaaaagctcttttatgaagaagatgaggcaggc
tctgctacgtcctgcctgtga

DBGET integrated database retrieval system