KEGG   Homo sapiens (human): 8793Help
Entry
8793              CDS       T01001                                 

Gene name
TNFRSF10D, CD264, DCR2, TRAIL-R4, TRAILR4, TRUNDD
Definition
tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain
Orthology
K04722  
tumor necrosis factor receptor superfamily member 10
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Apoptosis
Natural killer cell mediated cytotoxicity
Measles
Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8793 (TNFRSF10D)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    8793 (TNFRSF10D)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    8793 (TNFRSF10D)
 Human Diseases
  Infectious diseases
   05162 Measles
    8793 (TNFRSF10D)
   05164 Influenza A
    8793 (TNFRSF10D)
Cellular antigens [BR:hsa04090]
 Proteins
  8793 (TNFRSF10D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p21
AA seq 386 aa AA seqDB search
MGLWGQSVPTASSARAGRYPGARTASGTRPWLLDPKILKFVVFIVAVLLPVRVDSATIPR
QDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTV
CKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKC
KNESAASSTGKTPAAEETVTTILGMLASPYHYLIIIVVLVIILAVVVVGFSCRKKFISYL
KGICSGGGGGPERVHRVLFRRRSCPSRVPGAEDNARNETLSNRYLQPTQVSEQEIQGQEL
AELTGVTVELPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKE
TIQDQLVGSEKLFYEEDEAGSATSCL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgggactttggggacaaagcgtcccgaccgcctcgagcgctcgagcagggcgctatcca
ggagccaggacagcgtcgggaaccagaccatggctcctggaccccaagatccttaagttc
gtcgtcttcatcgtcgcggttctgctgccggtccgggttgactctgccaccatcccccgg
caggacgaagttccccagcagacagtggccccacagcaacagaggcgcagcctcaaggag
gaggagtgtccagcaggatctcatagatcagaatatactggagcctgtaacccgtgcaca
gagggtgtggattacaccattgcttccaacaatttgccttcttgcctgctatgtacagtt
tgtaaatcaggtcaaacaaataaaagttcctgtaccacgaccagagacaccgtgtgtcag
tgtgaaaaaggaagcttccaggataaaaactcccctgagatgtgccggacgtgtagaaca
gggtgtcccagagggatggtcaaggtcagtaattgtacgccccggagtgacatcaagtgc
aaaaatgaatcagctgccagttccactgggaaaaccccagcagcggaggagacagtgacc
accatcctggggatgcttgcctctccctatcactaccttatcatcatagtggttttagtc
atcattttagctgtggttgtggttggcttttcatgtcggaagaaattcatttcttacctc
aaaggcatctgctcaggtggtggaggaggtcccgaacgtgtgcacagagtccttttccgg
cggcgttcatgtccttcacgagttcctggggcggaggacaatgcccgcaacgagaccctg
agtaacagatacttgcagcccacccaggtctctgagcaggaaatccaaggtcaggagctg
gcagagctaacaggtgtgactgtagagttgccagaggagccacagcgtctgctggaacag
gcagaagctgaagggtgtcagaggaggaggctgctggttccagtgaatgacgctgactcc
gctgacatcagcaccttgctggatgcctcggcaacactggaagaaggacatgcaaaggaa
acaattcaggaccaactggtgggctccgaaaagctcttttatgaagaagatgaggcaggc
tctgctacgtcctgcctgtga

DBGET integrated database retrieval system