KEGG   Homo sapiens (human): 8794Help
Entry
8794              CDS       T01001                                 

Gene name
TNFRSF10C, CD263, DCR1, DCR1-TNFR, LIT, TRAIL-R3, TRAILR3, TRID
Definition
tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
Orthology
K04722  
tumor necrosis factor receptor superfamily member 10
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Apoptosis
Natural killer cell mediated cytotoxicity
Measles
Influenza A
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p22-p21
AA seq 259 aa AA seqDB search
MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRS
EHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNEN
SPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAE
ETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPASSHY
LSCTIVGIIVLIVLLIVFV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcccggatccccaagaccctaaagttcgtcgtcgtcatcgtcgcggtcctgctgcca
gtcctagcttactctgccaccactgcccggcaggaggaagttccccagcagacagtggcc
ccacagcaacagaggcacagcttcaagggggaggagtgtccagcaggatctcatagatca
gaacatactggagcctgtaacccgtgcacagagggtgtggattacaccaacgcttccaac
aatgaaccttcttgcttcccatgtacagtttgtaaatcagatcaaaaacataaaagttcc
tgcaccatgaccagagacacagtgtgtcagtgtaaagaaggcaccttccggaatgaaaac
tccccagagatgtgccggaagtgtagcaggtgccctagtggggaagtccaagtcagtaat
tgtacgtcctgggatgatatccagtgtgttgaagaatttggtgccaatgccactgtggaa
accccagctgctgaagagacaatgaacaccagcccggggactcctgccccagctgctgaa
gagacaatgaacaccagcccagggactcctgccccagctgctgaagagacaatgaccacc
agcccggggactcctgccccagctgctgaagagacaatgaccaccagcccggggactcct
gccccagctgctgaagagacaatgaccaccagcccggggactcctgcctcttctcattac
ctctcatgcaccatcgtagggatcatagttctaattgtgcttctgattgtgtttgtttga

DBGET integrated database retrieval system