KEGG   Homo sapiens (human): 8794Help
Entry
8794              CDS       T01001                                 

Gene name
TNFRSF10C, CD263, DCR1, DCR1-TNFR, LIT, TRAIL-R3, TRAILR3, TRID
Definition
tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
Orthology
K04722  
tumor necrosis factor receptor superfamily member 10
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Apoptosis
Natural killer cell mediated cytotoxicity
Measles
Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8794 (TNFRSF10C)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    8794 (TNFRSF10C)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    8794 (TNFRSF10C)
 Human Diseases
  Infectious diseases
   05162 Measles
    8794 (TNFRSF10C)
   05164 Influenza A
    8794 (TNFRSF10C)
Cellular antigens [BR:hsa04090]
 Proteins
  8794 (TNFRSF10C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p22-p21
AA seq 259 aa AA seqDB search
MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRS
EHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNEN
SPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAE
ETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPASSHY
LSCTIVGIIVLIVLLIVFV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcccggatccccaagaccctaaagttcgtcgtcgtcatcgtcgcggtcctgctgcca
gtcctagcttactctgccaccactgcccggcaggaggaagttccccagcagacagtggcc
ccacagcaacagaggcacagcttcaagggggaggagtgtccagcaggatctcatagatca
gaacatactggagcctgtaacccgtgcacagagggtgtggattacaccaacgcttccaac
aatgaaccttcttgcttcccatgtacagtttgtaaatcagatcaaaaacataaaagttcc
tgcaccatgaccagagacacagtgtgtcagtgtaaagaaggcaccttccggaatgaaaac
tccccagagatgtgccggaagtgtagcaggtgccctagtggggaagtccaagtcagtaat
tgtacgtcctgggatgatatccagtgtgttgaagaatttggtgccaatgccactgtggaa
accccagctgctgaagagacaatgaacaccagcccggggactcctgccccagctgctgaa
gagacaatgaacaccagcccagggactcctgccccagctgctgaagagacaatgaccacc
agcccggggactcctgccccagctgctgaagagacaatgaccaccagcccggggactcct
gccccagctgctgaagagacaatgaccaccagcccggggactcctgcctcttctcattac
ctctcatgcaccatcgtagggatcatagttctaattgtgcttctgattgtgtttgtttga

DBGET integrated database retrieval system