KEGG   Homo sapiens (human): 8794Help
Entry
8794              CDS       T01001                                 

Gene name
TNFRSF10C, CD263, DCR1, DCR1-TNFR, LIT, TRAIL-R3, TRAILR3, TRID
Definition
(RefSeq) TNF receptor superfamily member 10c
  KO
K04722  tumor necrosis factor receptor superfamily member 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04650  Natural killer cell mediated cytotoxicity
hsa05162  Measles
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8794 (TNFRSF10C)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    8794 (TNFRSF10C)
   04217 Necroptosis
    8794 (TNFRSF10C)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    8794 (TNFRSF10C)
 Human Diseases
  Infectious diseases
   05162 Measles
    8794 (TNFRSF10C)
   05164 Influenza A
    8794 (TNFRSF10C)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   8794 (TNFRSF10C)
CD molecules [BR:hsa04090]
 Proteins
  8794 (TNFRSF10C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Podoplanin
Motif
Other DBs
NCBI-GeneID: 8794
NCBI-ProteinID: NP_003832
OMIM: 603613
HGNC: 11906
Ensembl: ENSG00000173535
Vega: OTTHUMG00000097844
Pharos: O14798(Tbio)
UniProt: O14798
Position
8p21.3
AA seq 259 aa AA seqDB search
MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRS
EHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNEN
SPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAE
ETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPASSHY
LSCTIVGIIVLIVLLIVFV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcccggatccccaagaccctaaagttcgtcgtcgtcatcgtcgcggtcctgctgcca
gtcctagcttactctgccaccactgcccggcaggaggaagttccccagcagacagtggcc
ccacagcaacagaggcacagcttcaagggggaggagtgtccagcaggatctcatagatca
gaacatactggagcctgtaacccgtgcacagagggtgtggattacaccaacgcttccaac
aatgaaccttcttgcttcccatgtacagtttgtaaatcagatcaaaaacataaaagttcc
tgcaccatgaccagagacacagtgtgtcagtgtaaagaaggcaccttccggaatgaaaac
tccccagagatgtgccggaagtgtagcaggtgccctagtggggaagtccaagtcagtaat
tgtacgtcctgggatgatatccagtgtgttgaagaatttggtgccaatgccactgtggaa
accccagctgctgaagagacaatgaacaccagcccggggactcctgccccagctgctgaa
gagacaatgaacaccagcccagggactcctgccccagctgctgaagagacaatgaccacc
agcccggggactcctgccccagctgctgaagagacaatgaccaccagcccggggactcct
gccccagctgctgaagagacaatgaccaccagcccggggactcctgcctcttctcattac
ctctcatgcaccatcgtagggatcatagttctaattgtgcttctgattgtgtttgtttga

DBGET integrated database retrieval system