KEGG   Homo sapiens (human): 8795Help
Entry
8795              CDS       T01001                                 

Gene name
TNFRSF10B, CD262, DR5, KILLER, KILLER/DR5, TRAIL-R2, TRAILR2, TRICK2, TRICK2A, TRICK2B, TRICKB, ZTNFR9
Definition
tumor necrosis factor receptor superfamily, member 10b
Orthology
K04722  
tumor necrosis factor receptor superfamily member 10
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
p53 signaling pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Measles
Influenza A
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8795 (TNFRSF10B)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    8795 (TNFRSF10B)
   04115 p53 signaling pathway
    8795 (TNFRSF10B)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    8795 (TNFRSF10B)
 Human Diseases
  Infectious diseases
   05162 Measles
    8795 (TNFRSF10B)
   05164 Influenza A
    8795 (TNFRSF10B)
Cellular antigens [BR:hsa04090]
 Proteins
  8795 (TNFRSF10B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p22-p21
AA seq 440 aa AA seqDB search
MEQRGQNAPAASGARKRHGPGPREARGARPGPRVPKTLVLVVAAVLLLVSAESALITQQD
LAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCD
SGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVH
KESGTKHSGEVPAVEETVTSSPGTPASPCSLSGIIIGVTVAAVVLIVAVFVCKSLLWKKV
LPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGV
NMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRK
LGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIED
HLLSSGKFMYLEGNADSAMS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacggggacagaacgccccggccgcttcgggggcccggaaaaggcacggccca
ggacccagggaggcgcggggagccaggcctgggccccgggtccccaagacccttgtgctc
gttgtcgccgcggtcctgctgttggtctcagctgagtctgctctgatcacccaacaagac
ctagctccccagcagagagcggccccacaacaaaagaggtccagcccctcagagggattg
tgtccacctggacaccatatctcagaagacggtagagattgcatctcctgcaaatatgga
caggactatagcactcactggaatgacctccttttctgcttgcgctgcaccaggtgtgat
tcaggtgaagtggagctaagtccctgcaccacgaccagaaacacagtgtgtcagtgcgaa
gaaggcaccttccgggaagaagattctcctgagatgtgccggaagtgccgcacagggtgt
cccagagggatggtcaaggtcggtgattgtacaccctggagtgacatcgaatgtgtccac
aaagaatcaggtacaaagcacagtggggaagtcccagctgtggaggagacggtgacctcc
agcccagggactcctgcctctccctgttctctctcaggcatcatcataggagtcacagtt
gcagccgtagtcttgattgtggctgtgtttgtttgcaagtctttactgtggaagaaagtc
cttccttacctgaaaggcatctgctcaggtggtggtggggaccctgagcgtgtggacaga
agctcacaacgacctggggctgaggacaatgtcctcaatgagatcgtgagtatcttgcag
cccacccaggtccctgagcaggaaatggaagtccaggagccagcagagccaacaggtgtc
aacatgttgtcccccggggagtcagagcatctgctggaaccggcagaagctgaaaggtct
cagaggaggaggctgctggttccagcaaatgaaggtgatcccactgagactctgagacag
tgcttcgatgactttgcagacttggtgccctttgactcctgggagccgctcatgaggaag
ttgggcctcatggacaatgagataaaggtggctaaagctgaggcagcgggccacagggac
accttgtacacgatgctgataaagtgggtcaacaaaaccgggcgagatgcctctgtccac
accctgctggatgccttggagacgctgggagagagacttgccaagcagaagattgaggac
cacttgttgagctctggaaagttcatgtatctagaaggtaatgcagactctgccatgtcc
taa

DBGET integrated database retrieval system