KEGG   Homo sapiens (human): 8795Help
Entry
8795              CDS       T01001                                 

Gene name
TNFRSF10B, CD262, DR5, KILLER, KILLER/DR5, TRAIL-R2, TRAILR2, TRICK2, TRICK2A, TRICK2B, TRICKB, ZTNFR9
Definition
tumor necrosis factor receptor superfamily, member 10b
Orthology
K04722  
tumor necrosis factor receptor superfamily member 10
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
p53 signaling pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Measles
Influenza A
Drug target
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p22-p21
AA seq 440 aa AA seqDB search
MEQRGQNAPAASGARKRHGPGPREARGARPGPRVPKTLVLVVAAVLLLVSAESALITQQD
LAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCD
SGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVH
KESGTKHSGEVPAVEETVTSSPGTPASPCSLSGIIIGVTVAAVVLIVAVFVCKSLLWKKV
LPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGV
NMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRK
LGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIED
HLLSSGKFMYLEGNADSAMS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacggggacagaacgccccggccgcttcgggggcccggaaaaggcacggccca
ggacccagggaggcgcggggagccaggcctgggccccgggtccccaagacccttgtgctc
gttgtcgccgcggtcctgctgttggtctcagctgagtctgctctgatcacccaacaagac
ctagctccccagcagagagcggccccacaacaaaagaggtccagcccctcagagggattg
tgtccacctggacaccatatctcagaagacggtagagattgcatctcctgcaaatatgga
caggactatagcactcactggaatgacctccttttctgcttgcgctgcaccaggtgtgat
tcaggtgaagtggagctaagtccctgcaccacgaccagaaacacagtgtgtcagtgcgaa
gaaggcaccttccgggaagaagattctcctgagatgtgccggaagtgccgcacagggtgt
cccagagggatggtcaaggtcggtgattgtacaccctggagtgacatcgaatgtgtccac
aaagaatcaggtacaaagcacagtggggaagtcccagctgtggaggagacggtgacctcc
agcccagggactcctgcctctccctgttctctctcaggcatcatcataggagtcacagtt
gcagccgtagtcttgattgtggctgtgtttgtttgcaagtctttactgtggaagaaagtc
cttccttacctgaaaggcatctgctcaggtggtggtggggaccctgagcgtgtggacaga
agctcacaacgacctggggctgaggacaatgtcctcaatgagatcgtgagtatcttgcag
cccacccaggtccctgagcaggaaatggaagtccaggagccagcagagccaacaggtgtc
aacatgttgtcccccggggagtcagagcatctgctggaaccggcagaagctgaaaggtct
cagaggaggaggctgctggttccagcaaatgaaggtgatcccactgagactctgagacag
tgcttcgatgactttgcagacttggtgccctttgactcctgggagccgctcatgaggaag
ttgggcctcatggacaatgagataaaggtggctaaagctgaggcagcgggccacagggac
accttgtacacgatgctgataaagtgggtcaacaaaaccgggcgagatgcctctgtccac
accctgctggatgccttggagacgctgggagagagacttgccaagcagaagattgaggac
cacttgttgagctctggaaagttcatgtatctagaaggtaatgcagactctgccatgtcc
taa

DBGET integrated database retrieval system