KEGG   Homo sapiens (human): 8797Help
Entry
8797              CDS       T01001                                 

Gene name
TNFRSF10A, APO2, CD261, DR4, TRAILR-1, TRAILR1
Definition
tumor necrosis factor receptor superfamily, member 10a
Orthology
K04722  
tumor necrosis factor receptor superfamily member 10
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Apoptosis
Natural killer cell mediated cytotoxicity
Measles
Influenza A
Drug target
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
8p21
AA seq 468 aa AA seqDB search
MAPPPARVHLGAFLAVTPNPGSAASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMG
QHGPSARARAGRAPGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGT
QQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPC
TTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHNI
WVILVVTLVVPLLLVAVLIVCCCIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEIL
SNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADP
TETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTG
RNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaccaccagctagagtacatctaggtgcgttcctggcagtgactccgaatccc
gggagcgcagcgagtgggacagaggcagccgcggccacacccagcaaagtgtggggctct
tccgcggggaggattgaaccacgaggcgggggccgaggagcgctccctacctccatggga
cagcacggacccagtgcccgggcccgggcagggcgcgccccaggacccaggccggcgcgg
gaagccagccctcggctccgggtccacaagaccttcaagtttgtcgtcgtcggggtcctg
ctgcaggtcgtacctagctcagctgcaaccatcaaacttcatgatcaatcaattggcaca
cagcaatgggaacatagccctttgggagagttgtgtccaccaggatctcatagatcagaa
catcctggagcctgtaaccggtgcacagagggtgtgggttacaccaatgcttccaacaat
ttgtttgcttgcctcccatgtacagcttgtaaatcagatgaagaagagagaagtccctgc
accacgaccaggaacacagcatgtcagtgcaaaccaggaactttccggaatgacaattct
gctgagatgtgccggaagtgcagcagagggtgccccagagggatggtcaaggtcaaggat
tgtacgccctggagtgacatcgagtgtgtccacaaagaatcaggcaatggacataatata
tgggtgattttggttgtgactttggttgttccgttgctgttggtggctgtgctgattgtc
tgttgttgcatcggctcaggttgtggaggggaccccaagtgcatggacagggtgtgtttc
tggcgcttgggtctcctacgagggcctggggctgaggacaatgctcacaacgagattctg
agcaacgcagactcgctgtccactttcgtctctgagcagcaaatggaaagccaggagccg
gcagatttgacaggtgtcactgtacagtccccaggggaggcacagtgtctgctgggaccg
gcagaagctgaagggtctcagaggaggaggctgctggttccagcaaatggtgctgacccc
actgagactctgatgctgttctttgacaagtttgcaaacatcgtgccctttgactcctgg
gaccagctcatgaggcagctggacctcacgaaaaatgagatcgatgtggtcagagctggt
acagcaggcccaggggatgccttgtatgcaatgctgatgaaatgggtcaacaaaactgga
cggaacgcctcgatccacaccctgctggatgccttggagaggatggaagagagacatgca
agagagaagattcaggacctcttggtggactctggaaagttcatctacttagaagatggc
acaggctctgccgtgtccttggagtga

DBGET integrated database retrieval system