KEGG   Homo sapiens (human): 8797Help
Entry
8797              CDS       T01001                                 

Gene name
TNFRSF10A, APO2, CD261, DR4, TRAILR-1, TRAILR1
Definition
tumor necrosis factor receptor superfamily, member 10a
Orthology
K04722  
tumor necrosis factor receptor superfamily member 10
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Apoptosis
Natural killer cell mediated cytotoxicity
Measles
Influenza A
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8797 (TNFRSF10A)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    8797 (TNFRSF10A)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    8797 (TNFRSF10A)
 Human Diseases
  Infectious diseases
   05162 Measles
    8797 (TNFRSF10A)
   05164 Influenza A
    8797 (TNFRSF10A)
Cellular antigens [BR:hsa04090]
 Proteins
  8797 (TNFRSF10A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
8p21
AA seq 468 aa AA seqDB search
MAPPPARVHLGAFLAVTPNPGSAASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMG
QHGPSARARAGRAPGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGT
QQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPC
TTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHNI
WVILVVTLVVPLLLVAVLIVCCCIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEIL
SNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADP
TETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTG
RNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaccaccagctagagtacatctaggtgcgttcctggcagtgactccgaatccc
gggagcgcagcgagtgggacagaggcagccgcggccacacccagcaaagtgtggggctct
tccgcggggaggattgaaccacgaggcgggggccgaggagcgctccctacctccatggga
cagcacggacccagtgcccgggcccgggcagggcgcgccccaggacccaggccggcgcgg
gaagccagccctcggctccgggtccacaagaccttcaagtttgtcgtcgtcggggtcctg
ctgcaggtcgtacctagctcagctgcaaccatcaaacttcatgatcaatcaattggcaca
cagcaatgggaacatagccctttgggagagttgtgtccaccaggatctcatagatcagaa
catcctggagcctgtaaccggtgcacagagggtgtgggttacaccaatgcttccaacaat
ttgtttgcttgcctcccatgtacagcttgtaaatcagatgaagaagagagaagtccctgc
accacgaccaggaacacagcatgtcagtgcaaaccaggaactttccggaatgacaattct
gctgagatgtgccggaagtgcagcagagggtgccccagagggatggtcaaggtcaaggat
tgtacgccctggagtgacatcgagtgtgtccacaaagaatcaggcaatggacataatata
tgggtgattttggttgtgactttggttgttccgttgctgttggtggctgtgctgattgtc
tgttgttgcatcggctcaggttgtggaggggaccccaagtgcatggacagggtgtgtttc
tggcgcttgggtctcctacgagggcctggggctgaggacaatgctcacaacgagattctg
agcaacgcagactcgctgtccactttcgtctctgagcagcaaatggaaagccaggagccg
gcagatttgacaggtgtcactgtacagtccccaggggaggcacagtgtctgctgggaccg
gcagaagctgaagggtctcagaggaggaggctgctggttccagcaaatggtgctgacccc
actgagactctgatgctgttctttgacaagtttgcaaacatcgtgccctttgactcctgg
gaccagctcatgaggcagctggacctcacgaaaaatgagatcgatgtggtcagagctggt
acagcaggcccaggggatgccttgtatgcaatgctgatgaaatgggtcaacaaaactgga
cggaacgcctcgatccacaccctgctggatgccttggagaggatggaagagagacatgca
agagagaagattcaggacctcttggtggactctggaaagttcatctacttagaagatggc
acaggctctgccgtgtccttggagtga

DBGET integrated database retrieval system