KEGG   Homo sapiens (human): 883Help
Entry
883               CDS       T01001                                 

Gene name
CCBL1, GTK, KAT1, KATI
Definition
cysteine conjugate-beta lyase, cytoplasmic (EC:2.6.1.64 2.6.1.7 4.4.1.13)
Orthology
K00816  
kynurenine---oxoglutarate transaminase / cysteine-S-conjugate beta-lyase / glutamine---phenylpyruvate transaminase [EC:2.6.1.7 4.4.1.13 2.6.1.64]
Organism
hsa  Homo sapiens (human)
Pathway
Tryptophan metabolism
Selenocompound metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    883 (CCBL1)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    883 (CCBL1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    883 (CCBL1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.7  kynurenine---oxoglutarate transaminase
     883 (CCBL1)
    2.6.1.64  glutamine---phenylpyruvate transaminase
     883 (CCBL1)
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     883 (CCBL1)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class I
   883 (CCBL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.11
AA seq 422 aa AA seqDB search
MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFML
NQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVII
IEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVL
NTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTL
TIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFR
QPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDE
PYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKV
EL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacagctgcaggcccgaaggctagacgggatcgactacaacccctgggtggag
tttgtgaaactggccagtgagcatgacgtcgtgaacttgggccagggcttcccggatttc
ccaccaccagactttgccgtggaagcctttcagcacgctgtcagtggagacttcatgctt
aaccagtacaccaagacatttggttacccaccactgacgaagatcctggcaagtttcttt
ggggagctgctgggtcaggagatagacccgctcaggaatgtgctggtgactgttggtggc
tatggggccctgttcacagccttccaggccctggtggacgaaggagacgaggtcatcatc
atcgaacccttttttgactgctacgagcccatgacaatgatggcagggggtcgtcctgtg
tttgtgtccctgaagccgggtcccatccagaatggagaactgggttccagcagcaactgg
cagctggaccccatggagctggccggcaaattcacatcacgcaccaaagccctggtcctc
aacacccccaacaaccccctgggcaaggtgttctccagggaagagctggagctggtggcc
agcctttgccagcagcatgacgtggtgtgtatcactgatgaagtctaccagtggatggtc
tacgacgggcaccagcacatcagcattgccagcctccctggcatgtgggaacggaccctg
accatcggcagcgccggcaagaccttcagcgccactggctggaaggtgggctgggtcctg
ggtccagatcacatcatgaagcacctgcggaccgtgcaccagaactccgtcttccactgc
cccacgcagagccaggctgcagtagccgagagctttgaacgggagcagctgctcttccgc
caacccagcagctactttgtgcagttcccgcaggccatgcagcgctgccgtgaccacatg
atacgtagcctacagtcagtgggcctgaagcccatcatccctcagggcagctacttcctc
atcacagacatctcagacttcaagaggaagatgcctgacttgcctggagctgtggatgag
ccctatgacagacgcttcgtcaagtggatgatcaagaacaagggcttggtggccatccct
gtctccatcttctatagtgtgccacatcagaagcactttgaccactatatccgcttctgt
tttgtgaaggatgaagccacgctccaggccatggacgagaagctgcggaagtggaaggtg
gaactctag

DBGET integrated database retrieval system