KEGG   Homo sapiens (human): 8851Help
Entry
8851              CDS       T01001                                 

Gene name
CDK5R1, CDK5P35, CDK5R, NCK5A, p23, p25, p35, p35nck5a
Definition
cyclin-dependent kinase 5, regulatory subunit 1 (p35)
Orthology
K11716  
cyclin-dependent kinase 5 activator 1
Organism
hsa  Homo sapiens (human)
Pathway
Alzheimer's disease
Cocaine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    8851 (CDK5R1)
  Substance dependence
   05030 Cocaine addiction
    8851 (CDK5R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q11.2
AA seq 307 aa AA seqDB search
MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSA
KKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTG
GSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRS
VDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNE
ISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
LLLGLDR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgggcacggtgctgtccctgtctcccagctaccggaaggccacgctgtttgaggatggc
gcggccaccgtgggccactatacggccgtacagaacagcaagaacgccaaggacaagaac
ctgaagcgccactccatcatctccgtgctgccttggaagagaatcgtggccgtgtcggcc
aagaagaagaactccaagaaggtgcagcccaacagcagctaccagaacaacatcacgcac
ctcaacaatgagaacctgaagaagtcgctgtcgtgcgccaacctgtccacattcgcccag
cccccaccggcccagccgcctgcacccccggccagccagctctcgggttcccagaccggg
ggctcctcctcagtcaagaaagcccctcaccctgccgtcacctccgcagggacgcccaaa
cgggtcatcgtccaggcgtccaccagtgagctgcttcgctgcctgggtgagtttctctgc
cgccggtgctaccgcctgaagcacctgtcccccacggaccccgtgctctggctgcgcagc
gtggaccgctcgctgcttctgcagggctggcaggaccagggcttcatcacgccggccaac
gtggtcttcctctacatgctctgcagggatgttatctcctccgaggtgggctcggatcac
gagctccaggccgtcctgctgacatgcctgtacctctcctactcctacatgggcaacgag
atctcctacccgctcaagcccttcctggtggagagctgcaaggaggccttttgggaccgt
tgcctctctgtcatcaacctcatgagctcaaagatgctgcagataaatgccgacccacac
tacttcacacaggtcttctccgacctgaagaacgagagcggccaggaggacaagaagcgg
ctcctcctaggcctggatcggtga

DBGET integrated database retrieval system