KEGG   Homo sapiens (human): 886Help
Entry
886               CDS       T01001                                 

Gene name
CCKAR, CCK-A, CCK1-R, CCK1R, CCKRA
Definition
cholecystokinin A receptor
Orthology
K04194  
cholecystokinin A receptor
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Insulin secretion
Pancreatic secretion
Drug target
Proglumide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    886 (CCKAR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    886 (CCKAR)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    886 (CCKAR)
  Digestive system
   04972 Pancreatic secretion
    886 (CCKAR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Gut peptide
   Cholecystokinin
    886 (CCKAR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p15.2
AA seq 428 aa AA seqDB search
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNS
SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSY
TSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH
MSASVPPQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggatgtggttgacagccttcttgtgaatggaagcaacatcactcctccctgtgaactc
gggctcgaaaatgagacgcttttctgcttggatcagccccgtccttccaaagagtggcag
ccagcggtgcagattctcttgtactccttgatattcctgctcagcgtgctgggaaacacg
ctggtcatcaccgtgctgattcggaacaagcggatgcggacggtcaccaacatcttcctc
ctctccctggctgtcagcgacctcatgctctgtctcttctgcatgccgttcaacctcatc
cccaatctgctcaaggatttcatcttcgggagcgccgtttgcaagaccaccacctacttc
atgggcacctctgtgagtgtatctacctttaatctggtagccatatctctagagagatat
ggtgcgatttgcaaacccttacagtcccgggtctggcagacaaaatcccatgctttgaag
gtgattgctgctacctggtgcctttcctttaccatcatgactccgtaccccatttatagc
aacttggtgccttttaccaaaaataacaaccagaccgcgaatatgtgccgctttctactg
ccaaatgatgttatgcagcagtcctggcacacattcctgttactcatcctctttcttatt
cctggaattgtgatgatggtggcatatggattaatctctttggaactctaccagggaata
aaatttgaggctagccagaagaagtctgctaaagaaaggaaacctagcaccaccagcagc
ggcaaatatgaggacagcgatgggtgttacctgcaaaagaccaggcccccgaggaagctg
gagctccggcagctgtccaccggcagcagcagcagggccaaccgcatccggagtaacagc
tccgcagccaacctgatggccaagaaaagggtgatccgcatgctcatcgtcatcgtggtc
ctcttcttcctgtgctggatgcccatcttcagcgccaacgcctggcgggcctacgacacc
gcctccgcagagcgccgcctctcaggaacccccatttccttcatcctcctcctgtcctac
acctcctcctgcgtcaaccccatcatctactgcttcatgaacaaacgcttccgcctcggc
ttcatggccaccttcccctgctgccccaatcctggtcccccaggggcgaggggagaggtg
ggggaggaggaggaaggcgggaccacaggagcctctctgtccaggttctcgtacagccat
atgagtgcctcggtgccaccccagtga

DBGET integrated database retrieval system