KEGG   Homo sapiens (human): 8863Help
Entry
8863              CDS       T01001                                 

Gene name
PER3, FASPS3, GIG13
Definition
(RefSeq) period circadian clock 3
  KO
K02633  
period circadian protein
Organism
hsa  Homo sapiens (human)
Pathway
Circadian rhythm
Circadian entrainment
Herpes simplex infection
Disease
H00688  
Familial advanced sleep phase syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    8863 (PER3)
   04713 Circadian entrainment
    8863 (PER3)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    8863 (PER3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    8863 (PER3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P56645(Tbio)
UniProt: 
Position
1p36.23
AA seq 1201 aa AA seqDB search
MPRGEAPGPGRRGAKDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQ
EMKKYFPSERRNKPSTLDALNYALRCVHSVQANSEFFQILSQNGAPQADVSMYSLEELAT
IASEHTSKNTDTFVAVFSFLSGRLVHISEQAALILNRKKDVLASSHFVDLLAPQDMRVFY
AHTARAQLPFWNNWTQRAARYECAPVKPFFCRIRGGEDRKQEKCHSPFRIIPYLIHVHHP
AQPELESEPCCLTVVEKIHSGYEAPRIPVNKRIFTTTHTPGCVFLEVDEKAVPLLGYLPQ
DLIGTSILSYLHPEDRSLMVAIHQKVLKYAGHPPFEHSPIRFCTQNGDYIILDSSWSSFV
NPWSRKISFIIGRHKVRTSPLNEDVFATKIKKMNDNDKDITELQEQIYKLLLQPVHVSVS
SGYGSLGSSGSQEQLVSIASSSEASGHRVEETKAEQMTLQQVYASVNKIKNLGQQLYIES
MTKSSFKPVTGTRTEPNGGGECKTFTSFHQTLKNNSVYTEPCEDLRNDEHSPSYQQINCI
DSVIRYLKSYNIPALKRKCISCTNTTSSSSEEDKQNHKADDVQALQAGLQIPAIPKSEMP
TNGRSIDTGGGAPQILSTAMLSLGSGISQCGYSSTIVHVPPPETARDATLFCEPWTLNMQ
PAPLTSEEFKHVGLTAAVLSAHTQKEEQNYVDKFREKILSSPYSSYLQQESRSKAKYSYF
QGDSTSKQTRSAGCRKGKHKRKKLPEPPDSSSSNTGSGPRRGAHQNAQPCCPSAASSPHT
SSPTFPPAAMVPSQAPYLVPAFPLPAATSPGREYAAPGTAPEGLHGLPLSEGLQPYPAFP
FPYLDTFMTVFLPDPPVCPLLSPSFLPCPFLGATASSAISPSMSSAMSPTLDPPPSVTSQ
RREEEKWEAQSEGHPFITSRSSSPLQLNLLQEEMPRPSESPDQMRRNTCPQTEYCVTGNN
GSESSPATTGALSTGSPPRENPSHPTASALSTGSPPMKNPSHPTASALSTGSPPMKNPSH
PTASTLSMGLPPSRTPSHPTATVLSTGSPPSESPSRTGSAASGSSDSSIYLTSSVYSSKI
SQNGQQSQDVQKKETFPNVAEEPIWRMIRQTPERILMTYQVPERVKEVVLKEDLEKLESM
RQQQPQFSHGQKEELAKVYNWIQSQTVTQEIDIQACVTCENEDSADGAATSCGQVLVEDS
C
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcggggaagctcctggccccgggagacggggggctaaggacgaggccctgggc
gaagaatcgggggagcggtggagccccgagttccatctgcagaggaaattggcggacagc
agccacagtgaacagcaagatcgaaacagagtttctgaagaacttatcatggttgtccaa
gaaatgaaaaaatacttcccctcggagagacgcaataaaccaagcactctagatgccctc
aactatgctctccgctgtgtccacagcgttcaagcaaacagtgagtttttccagattctc
agtcagaatggagcacctcaggcagatgtgagcatgtacagtcttgaggagctggccact
atcgcttcagaacacacttccaaaaacacagatacctttgtggcagtattttcatttctg
tctggaaggttagtgcacatttctgaacaggctgctttgatcctgaatcgtaagaaagat
gtcctggcgtcttctcactttgttgacctgcttgcacctcaagacatgagggtattctac
gcgcacactgccagagctcagcttcctttctggaacaactggacccaaagagctgcacgg
tatgaatgtgctccggtgaaaccttttttctgcaggatccgtggaggtgaagacagaaag
caagagaagtgtcactccccattccggatcatcccctatctgattcatgtacatcaccct
gcccagccagaattggaatcggaaccttgctgtctcactgtggttgaaaagattcactct
ggttatgaagctcctcggatcccagtgaataaaagaatcttcaccaccacacacacccca
gggtgtgtttttcttgaagtagatgaaaaagcagtgcctttgctgggttacctacctcag
gacctgattggaacatcgatcctaagctacctgcaccctgaagatcgttctctgatggtt
gccatacaccaaaaagttttgaagtatgcagggcatcctccctttgaacattctcccatt
cgattttgtactcaaaacggagactacatcatactggattccagttggtccagctttgtg
aatccctggagccggaagatttctttcatcattggtcggcataaagttcgaacgagccca
ctaaatgaggatgtttttgctaccaaaattaaaaagatgaacgataatgacaaagacata
acagaattacaagaacaaatttacaaacttctcttacagccagttcacgtgagcgtgtcc
agcggctacgggagcctggggagcagcgggtcgcaggagcagcttgtcagcatcgcctcc
tccagtgaggccagtgggcaccgtgtggaggagacgaaggcggagcagatgaccttgcag
caggtctatgccagtgtgaacaaaattaaaaatctgggtcagcagctctacattgagtca
atgaccaaatcatcattcaagccagtgacggggacacgcacagaaccgaatggtggtggt
gaatgtaagacctttacttccttccaccaaacactgaaaaacaatagtgtgtacactgag
ccctgtgaggatttgaggaacgatgagcacagcccatcctatcaacagatcaactgtatc
gacagtgtcatcagatacctgaagagctacaacattccagctttgaaaagaaagtgtatc
tcctgtacaaatacaacttcttcctcctcagaagaagacaaacagaaccacaaggcagat
gatgtccaagccttacaagctggtttgcaaatcccagccatacctaaatcagaaatgcca
acaaatggacggtccatagacacaggaggaggagctccacagatcctgtccacggcgatg
ctgagcttggggtcgggcataagccaatgcggttacagcagcaccattgtccatgtccca
cccccagagacagccagggatgctaccctcttctgtgagccctggaccctgaacatgcag
ccagcccctttgacctcggaagaatttaaacacgtggggctcacagcggctgttctgtca
gcgcacacccagaaggaagagcagaattatgttgataaattccgagaaaagatcctgtca
tcaccctacagctcctatcttcagcaagaaagcaggagcaaagctaaatattcatatttt
caaggagattctacttccaagcagacgcggtcggccggctgcaggaaagggaagcacaag
cggaagaagctgccggagccgccagacagcagcagctcgaacaccggctctggtccccgc
aggggagcgcatcagaacgcacagccctgctgcccctccgcggcctcctctccgcacacc
tcgagcccgaccttcccacctgccgccatggtgcccagccaggccccttacctcgtccca
gcttttcccctcccagccgcgacctcacccggaagagaatacgcagcccccggaactgca
ccggaaggcctgcatgggctgcccttgtccgagggcttgcagccttacccagctttccct
tttccttacttggatacttttatgaccgttttcctgcctgacccccctgtctgtcctctg
ttgtcgccatcgtttttgccatgtccattcctgggggcgacagcctcttctgcgatatca
ccctcaatgtcgtcagcaatgagtccaactctggacccacccccttcagtcaccagccaa
aggagagaggaggaaaagtgggaggcacaaagcgaggggcacccgttcattacttcgaga
agcagctcacccttgcagttaaacttacttcaggaagagatgcccagaccctctgaatct
ccagatcagatgagaaggaacacgtgcccacaaactgagtattgtgttacaggcaacaat
ggcagtgagagcagtcctgctactaccggtgcactgtccacggggtcacctcccagggag
aatccatcccatcctactgccagcgctctgtccacaggatcgcctcccatgaagaatcca
tcccatcctactgccagcgctctgtccacaggatcgcctcccatgaagaatccatcccat
cctactgccagcacactgtccatgggattgcctcccagcaggactccatcccatcctact
gccactgttctgtccacggggtcacctcccagcgaatccccatccagaactggttcagca
gcatcaggaagcagcgacagcagtatataccttactagtagtgtttattcttctaaaatc
tcccaaaatgggcagcaatctcaggacgtacagaaaaaagaaacatttcctaatgtcgcc
gaagagcccatctggagaatgatacggcagacacctgagcgcattctcatgacataccag
gtacctgagagggttaaagaagttgtactaaaagaagacctggaaaagctagaaagtatg
aggcagcagcagccccagttttctcatgggcaaaaggaggagctggctaaggtgtataat
tggattcaaagccagactgtcactcaagaaatcgacattcaagcctgtgtcacttgtgaa
aatgaagattcagctgatggtgcggccacatcctgtggtcaggttctggtagaagacagc
tgttga

DBGET integrated database retrieval system