KEGG   Homo sapiens (human): 8863Help
Entry
8863              CDS       T01001                                 

Gene name
PER3, FASPS3, GIG13
Definition
(RefSeq) period circadian regulator 3
  KO
K21945  period circadian protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
hsa04713  Circadian entrainment
hsa05168  Herpes simplex infection
Disease
H00688  Familial advanced sleep phase syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    8863 (PER3)
   04713 Circadian entrainment
    8863 (PER3)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    8863 (PER3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    8863 (PER3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Period_C PAS_3 PAS PAS_11 DNA_Packaging
Motif
Other DBs
NCBI-GeneID: 8863
NCBI-ProteinID: NP_058515
OMIM: 603427
HGNC: 8847
Ensembl: ENSG00000049246
Vega: OTTHUMG00000001216
Pharos: P56645(Tbio)
UniProt: P56645 A2I2N5
Position
1p36.23
AA seq 1201 aa AA seqDB search
MPRGEAPGPGRRGAKDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQ
EMKKYFPSERRNKPSTLDALNYALRCVHSVQANSEFFQILSQNGAPQADVSMYSLEELAT
IASEHTSKNTDTFVAVFSFLSGRLVHISEQAALILNRKKDVLASSHFVDLLAPQDMRVFY
AHTARAQLPFWNNWTQRAARYECAPVKPFFCRIRGGEDRKQEKCHSPFRIIPYLIHVHHP
AQPELESEPCCLTVVEKIHSGYEAPRIPVNKRIFTTTHTPGCVFLEVDEKAVPLLGYLPQ
DLIGTSILSYLHPEDRSLMVAIHQKVLKYAGHPPFEHSPIRFCTQNGDYIILDSSWSSFV
NPWSRKISFIIGRHKVRTSPLNEDVFATKIKKMNDNDKDITELQEQIYKLLLQPVHVSVS
SGYGSLGSSGSQEQLVSIASSSEASGHRVEETKAEQMTLQQVYASVNKIKNLGQQLYIES
MTKSSFKPVTGTRTEPNGGGECKTFTSFHQTLKNNSVYTEPCEDLRNDEHSPSYQQINCI
DSVIRYLKSYNIPALKRKCISCTNTTSSSSEEDKQNHKADDVQALQAGLQIPAIPKSEMP
TNGRSIDTGGGAPQILSTAMLSLGSGISQCGYSSTIVHVPPPETARDATLFCEPWTLNMQ
PAPLTSEEFKHVGLTAAVLSAHTQKEEQNYVDKFREKILSSPYSSYLQQESRSKAKYSYF
QGDSTSKQTRSAGCRKGKHKRKKLPEPPDSSSSNTGSGPRRGAHQNAQPCCPSAASSPHT
SSPTFPPAAMVPSQAPYLVPAFPLPAATSPGREYAAPGTAPEGLHGLPLSEGLQPYPAFP
FPYLDTFMTVFLPDPPVCPLLSPSFLPCPFLGATASSAISPSMSSAMSPTLDPPPSVTSQ
RREEEKWEAQSEGHPFITSRSSSPLQLNLLQEEMPRPSESPDQMRRNTCPQTEYCVTGNN
GSESSPATTGALSTGSPPRENPSHPTASALSTGSPPMKNPSHPTASALSTGSPPMKNPSH
PTASTLSMGLPPSRTPSHPTATVLSTGSPPSESPSRTGSAASGSSDSSIYLTSSVYSSKI
SQNGQQSQDVQKKETFPNVAEEPIWRMIRQTPERILMTYQVPERVKEVVLKEDLEKLESM
RQQQPQFSHGQKEELAKVYNWIQSQTVTQEIDIQACVTCENEDSADGAATSCGQVLVEDS
C
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcggggaagctcctggccccgggagacggggggctaaggacgaggccctgggc
gaagaatcgggggagcggtggagccccgagttccatctgcagaggaaattggcggacagc
agccacagtgaacagcaagatcgaaacagagtttctgaagaacttatcatggttgtccaa
gaaatgaaaaaatacttcccctcggagagacgcaataaaccaagcactctagatgccctc
aactatgctctccgctgtgtccacagcgttcaagcaaacagtgagtttttccagattctc
agtcagaatggagcacctcaggcagatgtgagcatgtacagtcttgaggagctggccact
atcgcttcagaacacacttccaaaaacacagatacctttgtggcagtattttcatttctg
tctggaaggttagtgcacatttctgaacaggctgctttgatcctgaatcgtaagaaagat
gtcctggcgtcttctcactttgttgacctgcttgcacctcaagacatgagggtattctac
gcgcacactgccagagctcagcttcctttctggaacaactggacccaaagagctgcacgg
tatgaatgtgctccggtgaaaccttttttctgcaggatccgtggaggtgaagacagaaag
caagagaagtgtcactccccattccggatcatcccctatctgattcatgtacatcaccct
gcccagccagaattggaatcggaaccttgctgtctcactgtggttgaaaagattcactct
ggttatgaagctcctcggatcccagtgaataaaagaatcttcaccaccacacacacccca
gggtgtgtttttcttgaagtagatgaaaaagcagtgcctttgctgggttacctacctcag
gacctgattggaacatcgatcctaagctacctgcaccctgaagatcgttctctgatggtt
gccatacaccaaaaagttttgaagtatgcagggcatcctccctttgaacattctcccatt
cgattttgtactcaaaacggagactacatcatactggattccagttggtccagctttgtg
aatccctggagccggaagatttctttcatcattggtcggcataaagttcgaacgagccca
ctaaatgaggatgtttttgctaccaaaattaaaaagatgaacgataatgacaaagacata
acagaattacaagaacaaatttacaaacttctcttacagccagttcacgtgagcgtgtcc
agcggctacgggagcctggggagcagcgggtcgcaggagcagcttgtcagcatcgcctcc
tccagtgaggccagtgggcaccgtgtggaggagacgaaggcggagcagatgaccttgcag
caggtctatgccagtgtgaacaaaattaaaaatctgggtcagcagctctacattgagtca
atgaccaaatcatcattcaagccagtgacggggacacgcacagaaccgaatggtggtggt
gaatgtaagacctttacttccttccaccaaacactgaaaaacaatagtgtgtacactgag
ccctgtgaggatttgaggaacgatgagcacagcccatcctatcaacagatcaactgtatc
gacagtgtcatcagatacctgaagagctacaacattccagctttgaaaagaaagtgtatc
tcctgtacaaatacaacttcttcctcctcagaagaagacaaacagaaccacaaggcagat
gatgtccaagccttacaagctggtttgcaaatcccagccatacctaaatcagaaatgcca
acaaatggacggtccatagacacaggaggaggagctccacagatcctgtccacggcgatg
ctgagcttggggtcgggcataagccaatgcggttacagcagcaccattgtccatgtccca
cccccagagacagccagggatgctaccctcttctgtgagccctggaccctgaacatgcag
ccagcccctttgacctcggaagaatttaaacacgtggggctcacagcggctgttctgtca
gcgcacacccagaaggaagagcagaattatgttgataaattccgagaaaagatcctgtca
tcaccctacagctcctatcttcagcaagaaagcaggagcaaagctaaatattcatatttt
caaggagattctacttccaagcagacgcggtcggccggctgcaggaaagggaagcacaag
cggaagaagctgccggagccgccagacagcagcagctcgaacaccggctctggtccccgc
aggggagcgcatcagaacgcacagccctgctgcccctccgcggcctcctctccgcacacc
tcgagcccgaccttcccacctgccgccatggtgcccagccaggccccttacctcgtccca
gcttttcccctcccagccgcgacctcacccggaagagaatacgcagcccccggaactgca
ccggaaggcctgcatgggctgcccttgtccgagggcttgcagccttacccagctttccct
tttccttacttggatacttttatgaccgttttcctgcctgacccccctgtctgtcctctg
ttgtcgccatcgtttttgccatgtccattcctgggggcgacagcctcttctgcgatatca
ccctcaatgtcgtcagcaatgagtccaactctggacccacccccttcagtcaccagccaa
aggagagaggaggaaaagtgggaggcacaaagcgaggggcacccgttcattacttcgaga
agcagctcacccttgcagttaaacttacttcaggaagagatgcccagaccctctgaatct
ccagatcagatgagaaggaacacgtgcccacaaactgagtattgtgttacaggcaacaat
ggcagtgagagcagtcctgctactaccggtgcactgtccacggggtcacctcccagggag
aatccatcccatcctactgccagcgctctgtccacaggatcgcctcccatgaagaatcca
tcccatcctactgccagcgctctgtccacaggatcgcctcccatgaagaatccatcccat
cctactgccagcacactgtccatgggattgcctcccagcaggactccatcccatcctact
gccactgttctgtccacggggtcacctcccagcgaatccccatccagaactggttcagca
gcatcaggaagcagcgacagcagtatataccttactagtagtgtttattcttctaaaatc
tcccaaaatgggcagcaatctcaggacgtacagaaaaaagaaacatttcctaatgtcgcc
gaagagcccatctggagaatgatacggcagacacctgagcgcattctcatgacataccag
gtacctgagagggttaaagaagttgtactaaaagaagacctggaaaagctagaaagtatg
aggcagcagcagccccagttttctcatgggcaaaaggaggagctggctaaggtgtataat
tggattcaaagccagactgtcactcaagaaatcgacattcaagcctgtgtcacttgtgaa
aatgaagattcagctgatggtgcggccacatcctgtggtcaggttctggtagaagacagc
tgttga

DBGET integrated database retrieval system