KEGG   Homo sapiens (human): 8864Help
Entry
8864              CDS       T01001                                 

Gene name
PER2, FASPS, FASPS1
Definition
(RefSeq) period circadian clock 2
  KO
K02633  
period circadian protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Circadian rhythm
Circadian entrainment
Herpes simplex infection
Transcriptional misregulation in cancer
Acute myeloid leukemia
Disease
H00688  
Familial advanced sleep phase syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    8864 (PER2)
   04713 Circadian entrainment
    8864 (PER2)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    8864 (PER2)
   05221 Acute myeloid leukemia
    8864 (PER2)
  Infectious diseases
   05168 Herpes simplex infection
    8864 (PER2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    8864 (PER2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O15055(Tbio)
UniProt: 
Position
2q37.3
AA seq 1255 aa AA seqDB search
MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDD
SGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSDQSSKVDTHKELIKTLKELKV
HLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSEGHPCGADVPSYTVEEMES
VTSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHCKRDAFSDAKFVEFLAPHDVGVFH
SFTSPYKLPLWSMCSGADSFTQECMEEKSFFCRVSVRKSHENEIRYHPFRMTPYLVKVRD
QQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQD
LIETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFINP
WSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVPHSGSS
GYGSLGSNGSHEHLMSQTSSSDSNGHEDSRRRRAEICKNGNKTKNRSHYSHESGEQKKKS
VTEMQTNPPAEKKAVPAMEKDSLGVSFPEELACKNQPTCSYQQISCLDSVIRYLESCNEA
ATLKRKCEFPANVPALRSSDKRKATVSPGPHAGEAEPPSRVNSRTGVGTHLTSLALPGKA
ESVASLTSQCSYSSTIVHVGDKKPQPELEMVEDAASGPESLDCLAGPALACGLSQEKEPF
KKLGLTKEVLAAHTQKEEQSFLQKFKEIRKLSIFQSHCHYYLQERSKGQPSERTAPGLRN
TSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQSS
CPAVPFPAPVPAAYSLPVFPAPGTVAAPPAPPHASFTVPAVPVDLQHQFAVQPPPFPAPL
APVMAFMLPSYSFPSGTPNLPQAFFPSQPQFPSHPTLTSEMASASQPEFPSRTSIPRQPC
ACPATRATPPSAMGRASPPLFQSRSSSPLQLNLLQLEEAPEGGTGAMGTTGATETAAVGA
DCKPGTSRDQQPKAPLTRDEPSDTQNSDALSTSSGLLNLLLNEDLCSASGSAASESLGSG
SLGCDASPSGAGSSDTSHTSKYFGSIDSSENNHKAKMNTGMEESEHFIKCVLQDPIWLLM
ADADSSVMMTYQLPSRNLEAVLKEDREKLKLLQKLQPRFTESQKQELREVHQWMQTGGLP
AAIDVAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQT
NT seq 3768 nt NT seq  +upstreamnt  +downstreamnt
atgaatggatacgcggaatttccgcccagccccagtaaccccaccaaggagcccgtggag
ccccagcccagccaggtcccactgcaggaagatgtggacatgagcagtggctccagtgga
catgagaccaacgaaaactgctccacggggcgggactcgcagggcagtgactgtgacgac
agtgggaaggagctggggatgctggtggagccaccggatgcccgccagagtccagatacc
tttagcctgatgatggcaaaatctgaacacaacccatctacaagtggctgcagtagcgac
cagtcttcgaaagtggacacacacaaagaactgataaaaacactaaaggagctgaaggtc
cacctccctgcagacaagaaggccaagggcaaggccagtacgctggccaccttgaagtac
gccctcaggagcgtgaagcaggtgaaagccaatgaagagtattaccagctgctgatgtcc
agcgagggtcacccctgtggagcagacgtgccctcctacaccgtggaggagatggagagc
gttacctctgagcacattgtgaagaatgccgatatgtttgcggtggccgtgtccctggtg
tctgggaagatcctgtacatctctgaccaggttgcatccatatttcactgtaaaagagat
gccttcagcgatgccaagtttgtggagttcctggcgcctcacgatgtgggcgtgttccac
agtttcacctccccgtacaagcttcccttgtggagcatgtgcagtggagcagattctttt
actcaagaatgcatggaggagaaatctttcttttgccgtgtcagtgtccggaaaagccac
gagaatgaaatccgctaccaccccttccgcatgacgccctacctggtcaaggtgcgggac
caacaaggtgctgagagtcagctttgctgccttctgctggcagagagagtgcactctggt
tatgaagcccctagaattcctcctgaaaagagaatttttacaaccacccatacaccaaat
tgtttgttccaggatgtggatgaaagggcggtccctctcctgggctacctacctcaggac
ctgattgaaaccccagtgctcgtgcagctccaccctagtgacaggcccttgatgctggcc
atccacaaaaagatcctgcagtcaggcgggcagcctttcgactattctcccattcggttt
cgcgcccggaacggagagtacatcacgttggacaccagctggtccagcttcatcaaccca
tggagcaggaaaatctccttcatcattgggaggcacaaagtcagggtgggccctttgaat
gaggacgtgtttgcagcccacccctgcacagaggagaaggccctgcaccccagcattcag
gagctcacagagcagatccaccggctcctgctgcagcccgtcccccacagcggctccagt
ggctacgggagtctgggcagcaacgggtcccacgagcaccttatgagccagacctcctcc
agcgacagcaacggccatgaggactcacgccggaggagagccgaaatttgtaaaaatggt
aacaagaccaaaaatagaagtcattattctcatgaatctggagaacaaaagaaaaaatcc
gttacagaaatgcaaactaatcccccagctgagaagaaagctgtccctgccatggaaaag
gacagcctgggggtcagcttccccgaggagttggcctgcaagaaccagcccacctgctcc
taccagcagatcagctgcttggacagcgtcatcaggtacttggagagctgcaatgaggct
gccaccctgaagaggaaatgcgagttcccagcaaacgtcccagcgctaaggtccagtgat
aagcggaaggccacagtcagcccagggccacacgctggagaggcagagccgccctccagg
gtgaacagccgcacgggagtaggtacgcacctgacctcgctggcactgccgggcaaggca
gagagtgtggcgtcgctcaccagccagtgcagctacagcagcaccatcgtccatgtggga
gacaagaagccgcagccggagttagagatggtggaagatgctgcgagtgggccagaatcc
ctggactgcctggcgggccctgccctggcctgtggtctcagccaagagaaggagcccttc
aagaagctgggcctcaccaaggaggtactcgctgcacacacacagaaggaggagcagagc
ttcctgcagaagttcaaagaaataagaaaactcagcattttccagtcccactgccattac
tacttgcaagaaagatccaaggggcagccaagtgaacgaactgcccctggactaagaaat
acttccggaatagattcaccttggaaaaaaacaggaaagaacagaaaattgaagtccaag
cgggtcaaacctcgagactcatctgagagcaccggatctggggggcccgtgtccgcccgg
cccccgctggtgggcttgaacgccacagcctggtcaccctcagacacgtcccagtccagc
tgcccagccgtgccctttcccgccccagtgccagcagcttattcactgcccgtgtttcca
gcgccagggactgtggcagcacccccggcacctccccacgccagcttcacagtgcctgct
gtgcccgtggacctccagcaccagtttgcagtccagcccccacctttccctgcccctttg
gcgcctgtcatggcattcatgctacccagttattccttcccctcggggaccccaaacctg
ccccaggccttcttccccagccagcctcagtttccgagccaccccacactcacatccgag
atggcctctgcctcacagcctgagttccccagccggacctcgatccccagacagccatgt
gcttgtccagccacccgggccaccccaccatcggccatgggtagggcctccccaccgctc
tttcagtcccgcagcagctcgcccctgcagctcaacctgctgcagctggaggaagcccct
gagggtggcactggagccatggggaccacaggggccacagagacagcagctgtaggggcg
gactgcaaacctggcacttctcgggaccagcagccgaaggcgcctctgacccgtgatgaa
ccctcagacacacagaacagtgacgccctttccacgtcaagcggcctcctaaacctcctg
ctgaatgaggacctctgctcagcctcgggctctgctgcttcggagtctctgggctccggc
tcactgggctgcgacgcctccccgagtggggcaggcagtagtgacacaagtcataccagc
aaatattttggaagcattgactcctcagagaataatcacaaagcaaaaatgaacactggt
atggaagaaagtgagcatttcattaagtgcgtcctgcaggatcccatctggctgctgatg
gcagatgcggacagcagcgtcatgatgacgtaccagctgccttcccgaaatttagaagcg
gttttgaaggaggacagagagaagctgaagctcctacagaaactccagcccaggttcacg
gagagtcagaagcaggagctgcgcgaggtccaccagtggatgcagacgggcggcctgccc
gcagccatcgacgtggcagaatgtgtttactgtgaaaacaaggaaaaaggtaatatttgc
ataccatatgaggaagatattccttctctgggactcagcgaagtgtcggacaccaaagaa
gacgaaaatggatcccccttgaatcacaggatcgaagagcagacgtaa

DBGET integrated database retrieval system