KEGG   Homo sapiens (human): 8874Help
Entry
8874              CDS       T01001                                 

Gene name
ARHGEF7, BETA-PIX, COOL-1, COOL1, Nbla10314, P50, P50BP, P85, P85COOL1, P85SPR, PAK3, PIXB
Definition
Rho guanine nucleotide exchange factor (GEF) 7
Orthology
K13710  
Rho guanine nucleotide exchange factor 7
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q34
AA seq 803 aa AA seqDB search
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEP
RSESECLSNIREFLRGCGASLRLELLFPPSQPPQHLVTTILLSASTFDANDLYQGQNFNK
VLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMT
DNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVRE
VKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRP
LQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTL
YLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKEL
ERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNV
TYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSE
NHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSH
PVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPP
LRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAY
CTSAKTRQTLNSTWQGTDLMHNHVLADDDQPSLDSLGRRSSLSRLEPSDLSEDSDYDSIW
TAHSYRMGSTSRKSCCSYISHQN
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgaattccgccgagcaaaccgttacgtggctcatcactctgggggtgctggagtcgccc
aaaaaaaccatctcggacccggagggctttctgcaggcgtcgctgaaggatggggtggtc
ctctgcaggctgctggagcgcctgctccccgggaccatcgagaaagtctaccccgagccc
cggagcgagagcgagtgcctgagcaacatccgcgagttcctgcgcggctgcggggcttcc
ctgcggctggagctcctgtttcctccttcccagcctcctcagcatctggtaaccaccatt
ctcttgtctgcttctacgtttgatgcaaatgatttgtatcaggggcagaattttaacaag
gtcctcagttccttagtgactctaaataaagtaacagcagacatcgggctggggagtgac
tccgtgtgtgcccggccctcgtctcaccgcataaagtcttttgactcccttggatcacag
tctttgcacactcggacttcaaaactgttccagggccagtatcggagtttggacatgacc
gataatagcaacaatcaactggtagtaagagcaaagtttaacttccagcagaccaatgag
gacgagctttccttctcaaaaggagacgtcatccatgtcacccgtgtggaagagggaggc
tggtgggagggcacactcaacggccggaccggctggttccccagcaactacgtgcgcgag
gtcaaggccagcgagaagcctgtgtctcccaaatcaggaacactgaagagccctcccaaa
ggatttgatacgactgccataaacaaaagctattacaatgtggtgctacagaatatttta
gaaacagaaaatgaatattctaaagaacttcagactgtgctttcaacgtacctacggcca
ttgcagaccagtgagaagttaagttcagcaaacatttcatatttaatgggaaatctagaa
gaaatatgttctttccagcaaatgctcgtacagtctttagaagaatgcaccaagttgccc
gaagctcagcagagagtcggaggctgctttttaaacctgatgccacagatgaaaaccctg
tacctcacgtattgtgccaatcacccttctgcagtgaatgtcctcacggaacacagtgag
gagttgggggagttcatggagaccaaaggtgccagcagccctgggattctcgtgctgacc
acgggcctgagcaaacccttcatgcgcctggataaataccctacgctgctcaaagagctc
gagagacacatggaggattatcatacagatagacaagatattcaaaaatccatggctgcc
ttcaaaaacctttcagcccaatgtcaagaagtccggaagaggaaagagcttgagctgcag
atcctgacggaagccatccggaactgggagggcgatgacattaaaactctgggcaacgtc
acttacatgtcccaggtcctgattcagtgtgccggaagtgaggaaaagaatgaaagatat
cttctactcttcccaaatgttttgctaatgttgtctgccagtcctaggatgagtggcttt
atctatcagggaaagcttccaacgacaggaatgacaatcacaaagcttgaggacagtgaa
aatcatagaaatgcatttgaaatatcagggagcatgattgagcggatattagtgtcgtgc
aacaaccagcaggatctgcaggaatgggtggagcacctacagaagcaaacgaaggtcacg
tctgtgggaaaccccaccataaagcctcattcagtgccatctcataccctcccctcccac
ccggtcactccgtccagcaagcacgcagacagcaagcccgcgccgctgacgcccgcctac
cacacgctgccccacccctcccaccacggcaccccgcacaccaccatcaactggggaccc
ctggagcctccgaaaacacccaagccctggagcctgagctgcctgcggcccgcgcctccc
ctccggccctcagctgctctctgctacaaggaggatcttagtaagagccctaagaccatg
aaaaagctgctgcccaagcgcaaacctgaacggaagccttcagatgaggagttcgcgtcc
cggaaaagcacagctgctttggaagaagatgctcagattctgaaagtcattgaagcttac
tgcaccagcgccaaaacaaggcaaacactcaattcaacatggcaaggcactgacctgatg
cataatcacgtcttggctgatgatgaccaaccaagcctagactccctggggcgtcgcagt
agcctttctcgtttggagccttcagacctctcggaagactctgactatgacagtatatgg
acagcccatagttacagaatgggttctacatctcgtaagagctgttgctcatatatctct
caccagaactaa

DBGET integrated database retrieval system