KEGG   Homo sapiens (human): 890Help
Entry
890               CDS       T01001                                 

Gene name
CCNA2, CCN1, CCNA
Definition
(RefSeq) cyclin A2
  KO
K06627  
cyclin-A
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
AMPK signaling pathway
Cellular senescence
Progesterone-mediated oocyte maturation
Hepatitis B
Human papillomavirus infection
Epstein-Barr virus infection
Viral carcinogenesis
Module
Cell cycle - G2/M transition
Network
N00263  
EBV EBNA3C to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    890 (CCNA2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    890 (CCNA2)
   04218 Cellular senescence
    890 (CCNA2)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    890 (CCNA2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    890 (CCNA2)
  Infectious diseases
   05161 Hepatitis B
    890 (CCNA2)
   05169 Epstein-Barr virus infection
    890 (CCNA2)
   05165 Human papillomavirus infection
    890 (CCNA2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    890 (CCNA2)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    890 (CCNA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P20248(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
4q27
AA seq 432 aa AA seqDB search
MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRG
LAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKI
EREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIVLEDEKPVSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAF
HLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG
VSLLNPPETLNL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgttgggcaactctgcgccggggcctgcgacccgcgaggcgggctcggcgctgctagca
ttgcagcagacggcgctccaagaggaccaggagaatatcaacccggaaaaggcagcgccc
gtccaacaaccgcggacccgggccgcgctggcggtactgaagtccgggaacccgcggggt
ctagcgcagcagcagaggccgaagacgagacgggttgcaccccttaaggatcttcctgta
aatgatgagcatgtcaccgttcctccttggaaagcaaacagtaaacagcctgcgttcacc
attcatgtggatgaagcagaaaaagaagctcagaagaagccagctgaatctcaaaaaata
gagcgtgaagatgccctggcttttaattcagccattagtttacctggacccagaaaacca
ttggtccctcttgattatccaatggatggtagttttgagtcaccacatactatggacatg
tcaattgtattagaagatgaaaagccagtgagtgttaatgaagtaccagactaccatgag
gatattcacacataccttagggaaatggaggttaaatgtaaacctaaagtgggttacatg
aagaaacagccagacatcactaacagtatgagagctatcctcgtggactggttagttgaa
gtaggagaagaatataaactacagaatgagaccctgcatttggctgtgaactacattgat
aggttcctgtcttccatgtcagtgctgagaggaaaacttcagcttgtgggcactgctgct
atgctgttagcctcaaagtttgaagaaatataccccccagaagtagcagagtttgtgtac
attacagatgatacctacaccaagaaacaagttctgagaatggagcatctagttttgaaa
gtccttacttttgacttagctgctccaacagtaaatcagtttcttacccaatactttctg
catcagcagcctgcaaactgcaaagttgaaagtttagcaatgtttttgggagaattaagt
ttgatagatgctgacccatacctcaagtatttgccatcagttattgctggagctgccttt
catttagcactctacacagtcacgggacaaagctggcctgaatcattaatacgaaagact
ggatataccctggaaagtcttaagccttgtctcatggaccttcaccagacctacctcaaa
gcaccacagcatgcacaacagtcaataagagaaaagtacaaaaattcaaagtatcatggt
gtttctctcctcaacccaccagagacactaaatctgtaa

DBGET integrated database retrieval system