KEGG   Homo sapiens (human): 890Help
Entry
890               CDS       T01001                                 

Gene name
CCNA2, CCN1, CCNA
Definition
cyclin A2
Orthology
K06627  
cyclin A
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
AMPK signaling pathway
Progesterone-mediated oocyte maturation
Hepatitis B
Epstein-Barr virus infection
Viral carcinogenesis
Module
Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    890 (CCNA2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    890 (CCNA2)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    890 (CCNA2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    890 (CCNA2)
  Infectious diseases
   05161 Hepatitis B
    890 (CCNA2)
   05169 Epstein-Barr virus infection
    890 (CCNA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q27
AA seq 432 aa AA seqDB search
MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRG
LAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKI
EREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIVLEDEKPVSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAF
HLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG
VSLLNPPETLNL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgttgggcaactctgcgccggggcctgcgacccgcgaggcgggctcggcgctgctagca
ttgcagcagacggcgctccaagaggaccaggagaatatcaacccggaaaaggcagcgccc
gtccaacaaccgcggacccgggccgcgctggcggtactgaagtccgggaacccgcggggt
ctagcgcagcagcagaggccgaagacgagacgggttgcaccccttaaggatcttcctgta
aatgatgagcatgtcaccgttcctccttggaaagcaaacagtaaacagcctgcgttcacc
attcatgtggatgaagcagaaaaagaagctcagaagaagccagctgaatctcaaaaaata
gagcgtgaagatgccctggcttttaattcagccattagtttacctggacccagaaaacca
ttggtccctcttgattatccaatggatggtagttttgagtcaccacatactatggacatg
tcaattgtattagaagatgaaaagccagtgagtgttaatgaagtaccagactaccatgag
gatattcacacataccttagggaaatggaggttaaatgtaaacctaaagtgggttacatg
aagaaacagccagacatcactaacagtatgagagctatcctcgtggactggttagttgaa
gtaggagaagaatataaactacagaatgagaccctgcatttggctgtgaactacattgat
aggttcctgtcttccatgtcagtgctgagaggaaaacttcagcttgtgggcactgctgct
atgctgttagcctcaaagtttgaagaaatataccccccagaagtagcagagtttgtgtac
attacagatgatacctacaccaagaaacaagttctgagaatggagcatctagttttgaaa
gtccttacttttgacttagctgctccaacagtaaatcagtttcttacccaatactttctg
catcagcagcctgcaaactgcaaagttgaaagtttagcaatgtttttgggagaattaagt
ttgatagatgctgacccatacctcaagtatttgccatcagttattgctggagctgccttt
catttagcactctacacagtcacgggacaaagctggcctgaatcattaatacgaaagact
ggatataccctggaaagtcttaagccttgtctcatggaccttcaccagacctacctcaaa
gcaccacagcatgcacaacagtcaataagagaaaagtacaaaaattcaaagtatcatggt
gtttctctcctcaacccaccagagacactaaatctgtaa

DBGET integrated database retrieval system