KEGG   Homo sapiens (human): 8900Help
Entry
8900              CDS       T01001                                 

Gene name
CCNA1, CT146
Definition
cyclin A1
Orthology
K06627  
cyclin A
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
AMPK signaling pathway
Progesterone-mediated oocyte maturation
Hepatitis B
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    8900 (CCNA1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    8900 (CCNA1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    8900 (CCNA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8900 (CCNA1)
   05202 Transcriptional misregulation in cancers
    8900 (CCNA1)
   05203 Viral carcinogenesis
    8900 (CCNA1)
   05221 Acute myeloid leukemia
    8900 (CCNA1)
  Infectious diseases
   05161 Hepatitis B
    8900 (CCNA1)
   05169 Epstein-Barr virus infection
    8900 (CCNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q12.3-q13
AA seq 464 aa AA seqDB search
METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQPVESEAMHCSNPKSGVVLATVAR
GPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKA
LPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNT
VSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITE
GMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYE
EIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRT
ENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVP
CLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggagaccggctttcccgcaatcatgtaccctggatcttttattgggggctggggagaa
gagtatctcagctgggaaggaccggggctcccagatttcgtcttccagcagcccgtggag
tctgaagcaatgcactgcagcaaccccaagagtggagttgtgctggctacagtggcccga
ggtcccgatgcttgtcagatactcaccagagccccgctgggccaggatcccccgcagagg
acagtgctagggctgctaactgcaaatgggcagtacaggaggacctgtggccaggggatc
acaagaatcaggtgttattctggatcagaaaatgccttccctccagctggaaagaaagca
ctccctgactgtggggtccaagagccccccaagcaagggtttgacatctacatggatgaa
ctagagcagggggacagagacagctgctcggtcagagaggggatggcatttgaggatgtg
tatgaagtagacaccggcacactcaagtcagacctgcacttcctgctggatttcaacaca
gtttcccctatgctggtagattcatctctcctctcccagtctgaagatatatccagtctt
ggcacagatgtgataaatgtgactgaatatgctgaagaaatttatcagtaccttagggaa
gctgaaataaggcacagacccaaagcacactacatgaagaagcagccagacatcacggaa
ggcatgcgcacgattctggtggactggctggtggaggttggggaagaatataaacttcga
gcagagaccctgtatctggctgtcaacttcctggacaggttcctttcatgtatgtctgtt
ctgagagggaaactgcagctcgtaggaacagcagctatgcttttggcttcgaaatatgaa
gagatatatcctcctgaagtagacgagtttgtctatatcaccgatgatacatacacaaaa
cgacaactgttaaaaatggaacacttgcttctgaaagttctagcttttgatctgacagta
ccaaccaccaaccagtttctccttcagtacttgaggcgacaaggagtgtgcgtcaggact
gagaacctggctaagtacgtagcagagctgagtctacttgaagcagatccattcttgaaa
tatcttccttcactgatagctgcagcagctttttgcctggcaaactatactgtgaacaag
cacttttggccagaaacccttgctgcatttacagggtattcattaagtgaaattgtgcct
tgcctgagtgagcttcataaagcgtaccttgatataccccatcgacctcagcaagcaatt
agggagaagtacaaggcttcaaagtacctgtgtgtgtccctcatggagccacctgcagtt
cttcttctacaataa

DBGET integrated database retrieval system