KEGG   Homo sapiens (human): 891Help
Entry
891               CDS       T01001                                 

Gene name
CCNB1, CCNB
Definition
cyclin B1
Orthology
K05868  
cyclin B
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Cell cycle
Oocyte meiosis
p53 signaling pathway
Progesterone-mediated oocyte maturation
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:hsa04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q12
AA seq 433 aa AA seqDB search
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM
PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI
LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ
LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP
KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP
LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE
WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS
ALVQDLAKAVAKV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccgagtcaccaggaactcgaaaattaatgctgaaaataaggcgaagatcaac
atggcaggcgcaaagcgcgttcctacggcccctgctgcaacctccaagcccggactgagg
ccaagaacagctcttggggacattggtaacaaagtcagtgaacaactgcaggccaaaatg
cctatgaagaaggaagcaaaaccttcagctactggaaaagtcattgataaaaaactacca
aaacctcttgaaaaggtacctatgctggtgccagtgccagtgtctgagccagtgccagag
ccagaacctgagccagaacctgagcctgttaaagaagaaaaactttcgcctgagcctatt
ttggttgatactgcctctccaagcccaatggaaacatctggatgtgcccctgcagaagaa
gacctgtgtcaggctttctctgatgtaattcttgcagtaaatgatgtggatgcagaagat
ggagctgatccaaacctttgtagtgaatatgtgaaagatatttatgcttatctgagacaa
cttgaggaagagcaagcagtcagaccaaaatacctactgggtcgggaagtcactggaaac
atgagagccatcctaattgactggctagtacaggttcaaatgaaattcaggttgttgcag
gagaccatgtacatgactgtctccattattgatcggttcatgcagaataattgtgtgccc
aagaagatgctgcagctggttggtgtcactgccatgtttattgcaagcaaatatgaagaa
atgtaccctccagaaattggtgactttgcttttgtgactgacaacacttatactaagcac
caaatcagacagatggaaatgaagattctaagagctttaaactttggtctgggtcggcct
ctacctttgcacttccttcggagagcatctaagattggagaggttgatgtcgagcaacat
actttggccaaatacctgatggaactaactatgttggactatgacatggtgcactttcct
ccttctcaaattgcagcaggagctttttgcttagcactgaaaattctggataatggtgaa
tggacaccaactctacaacattacctgtcatatactgaagaatctcttcttccagttatg
cagcacctggctaagaatgtagtcatggtaaatcaaggacttacaaagcacatgactgtc
aagaacaagtatgccacatcgaagcatgctaagatcagcactctaccacagctgaattct
gcactagttcaagatttagccaaggctgtggcaaaggtgtaa

DBGET integrated database retrieval system