KEGG   Homo sapiens (human): 891Help
Entry
891               CDS       T01001                                 

Gene name
CCNB1, CCNB
Definition
(RefSeq) cyclin B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04115  p53 signaling pathway
hsa04218  Cellular senescence
hsa04914  Progesterone-mediated oocyte maturation
Module
hsa_M00693  Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    891 (CCNB1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    891 (CCNB1)
   04114 Oocyte meiosis
    891 (CCNB1)
   04115 p53 signaling pathway
    891 (CCNB1)
   04218 Cellular senescence
    891 (CCNB1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    891 (CCNB1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    891 (CCNB1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    891 (CCNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C Adeno_E1A TonB_N Trypan_PARP
Motif
Other DBs
NCBI-GeneID: 891
NCBI-ProteinID: NP_114172
OMIM: 123836
HGNC: 1579
Ensembl: ENSG00000134057
Vega: OTTHUMG00000097817
Pharos: P14635(Tchem)
UniProt: P14635
Structure
PDB: 

Jmol
Position
5q13.2
AA seq 433 aa AA seqDB search
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM
PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI
LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ
LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP
KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP
LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE
WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS
ALVQDLAKAVAKV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccgagtcaccaggaactcgaaaattaatgctgaaaataaggcgaagatcaac
atggcaggcgcaaagcgcgttcctacggcccctgctgcaacctccaagcccggactgagg
ccaagaacagctcttggggacattggtaacaaagtcagtgaacaactgcaggccaaaatg
cctatgaagaaggaagcaaaaccttcagctactggaaaagtcattgataaaaaactacca
aaacctcttgaaaaggtacctatgctggtgccagtgccagtgtctgagccagtgccagag
ccagaacctgagccagaacctgagcctgttaaagaagaaaaactttcgcctgagcctatt
ttggttgatactgcctctccaagcccaatggaaacatctggatgtgcccctgcagaagaa
gacctgtgtcaggctttctctgatgtaattcttgcagtaaatgatgtggatgcagaagat
ggagctgatccaaacctttgtagtgaatatgtgaaagatatttatgcttatctgagacaa
cttgaggaagagcaagcagtcagaccaaaatacctactgggtcgggaagtcactggaaac
atgagagccatcctaattgactggctagtacaggttcaaatgaaattcaggttgttgcag
gagaccatgtacatgactgtctccattattgatcggttcatgcagaataattgtgtgccc
aagaagatgctgcagctggttggtgtcactgccatgtttattgcaagcaaatatgaagaa
atgtaccctccagaaattggtgactttgcttttgtgactgacaacacttatactaagcac
caaatcagacagatggaaatgaagattctaagagctttaaactttggtctgggtcggcct
ctacctttgcacttccttcggagagcatctaagattggagaggttgatgtcgagcaacat
actttggccaaatacctgatggaactaactatgttggactatgacatggtgcactttcct
ccttctcaaattgcagcaggagctttttgcttagcactgaaaattctggataatggtgaa
tggacaccaactctacaacattacctgtcatatactgaagaatctcttcttccagttatg
cagcacctggctaagaatgtagtcatggtaaatcaaggacttacaaagcacatgactgtc
aagaacaagtatgccacatcgaagcatgctaagatcagcactctaccacagctgaattct
gcactagttcaagatttagccaaggctgtggcaaaggtgtaa

DBGET integrated database retrieval system