KEGG   Homo sapiens (human): 891Help
Entry
891               CDS       T01001                                 

Gene name
CCNB1, CCNB
Definition
cyclin B1
Orthology
K05868  
cyclin B
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Cell cycle
Oocyte meiosis
p53 signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    891 (CCNB1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    891 (CCNB1)
   04114 Oocyte meiosis
    891 (CCNB1)
   04115 p53 signaling pathway
    891 (CCNB1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    891 (CCNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q12
AA seq 433 aa AA seqDB search
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM
PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI
LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ
LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP
KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP
LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE
WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS
ALVQDLAKAVAKV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccgagtcaccaggaactcgaaaattaatgctgaaaataaggcgaagatcaac
atggcaggcgcaaagcgcgttcctacggcccctgctgcaacctccaagcccggactgagg
ccaagaacagctcttggggacattggtaacaaagtcagtgaacaactgcaggccaaaatg
cctatgaagaaggaagcaaaaccttcagctactggaaaagtcattgataaaaaactacca
aaacctcttgaaaaggtacctatgctggtgccagtgccagtgtctgagccagtgccagag
ccagaacctgagccagaacctgagcctgttaaagaagaaaaactttcgcctgagcctatt
ttggttgatactgcctctccaagcccaatggaaacatctggatgtgcccctgcagaagaa
gacctgtgtcaggctttctctgatgtaattcttgcagtaaatgatgtggatgcagaagat
ggagctgatccaaacctttgtagtgaatatgtgaaagatatttatgcttatctgagacaa
cttgaggaagagcaagcagtcagaccaaaatacctactgggtcgggaagtcactggaaac
atgagagccatcctaattgactggctagtacaggttcaaatgaaattcaggttgttgcag
gagaccatgtacatgactgtctccattattgatcggttcatgcagaataattgtgtgccc
aagaagatgctgcagctggttggtgtcactgccatgtttattgcaagcaaatatgaagaa
atgtaccctccagaaattggtgactttgcttttgtgactgacaacacttatactaagcac
caaatcagacagatggaaatgaagattctaagagctttaaactttggtctgggtcggcct
ctacctttgcacttccttcggagagcatctaagattggagaggttgatgtcgagcaacat
actttggccaaatacctgatggaactaactatgttggactatgacatggtgcactttcct
ccttctcaaattgcagcaggagctttttgcttagcactgaaaattctggataatggtgaa
tggacaccaactctacaacattacctgtcatatactgaagaatctcttcttccagttatg
cagcacctggctaagaatgtagtcatggtaaatcaaggacttacaaagcacatgactgtc
aagaacaagtatgccacatcgaagcatgctaagatcagcactctaccacagctgaattct
gcactagttcaagatttagccaaggctgtggcaaaggtgtaa

DBGET integrated database retrieval system