KEGG   Homo sapiens (human): 8911Help
Entry
8911              CDS       T01001                                 

Gene name
CACNA1I, Cav3.3, ca(v)3.3
Definition
calcium channel, voltage-dependent, T type, alpha 1I subunit
Orthology
K04856  
voltage-dependent calcium channel T type alpha-1I
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Circadian entrainment
Drug target
Mibefradil: 
Bepridil: 
Prilocaine: 
Ethosuximide: 
Valproic acid: 
Zonisamide: 
Penfluridol: 
Flunarizine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    8911 (CACNA1I)
   04020 Calcium signaling pathway
    8911 (CACNA1I)
 Organismal Systems
  Environmental adaptation
   04713 Circadian entrainment
    8911 (CACNA1I)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-1, CaVx.x
   8911 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.1
AA seq 2188 aa AA seqDB search
MAESASPPSSSAAAPAAEPGVTTEQPGPRSPPSSPPGLEEPLDGADPHVPHPDLAPIAFF
CLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFDD
FIFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTV
RVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCF
LEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDV
YDFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWV
EIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYL
SSSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQSRRQALGPEAPAPAKPGPH
AKEPRHYQLCPQHSPLDATPHTLVQPIPATLASDPASCPCCQHEDGRRPSGLGSTDSGQE
GSGSGSSAGGEDEADGDGARSSEDGASSELGKEEEEEEQADGAVWLCGDVWRETRAKLRG
IVDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFG
LFDYLRNPYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVL
MKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVF
QILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSY
SDEDQSSSNIEEFDKLQEGLDSSGDPKLCPIPMTPNGHLDPSLPLGGHLGPAGAAGPAPR
LSLQPDPMLVALGSRKSSVMSLGRMSYDQRSLSSSRSSYYGPWGRSAAWASRRSSWNSLK
HKPPSAEHESLLSAERGGGARVCEVAADEGPPRAAPLHTPHAHHIHHGPHLAHRHRHHRR
TLSLDNRDSVDLAELVPAVGAHPRAAWRAAGPAPGHEDCNGRMPSIAKDVFTKMGDRGDR
GEDEEEIDYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENRFRVLCQTIIAHKLFDYV
VLAFIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAY
LRSSWNVLDGFLVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLV
VETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCMAANYR
WVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFL
LIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCH
TRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAV
LKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARV
LKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGM
SRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVL
TAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAELELEMAHGLGPGPRLPTGSPGAPGRG
PGGAGGGGDTEGGLCRRCYSPAQENLWLDSVSLIIKDSLEGELTIIDNLSGSIFHHYSSP
AGCKKCHHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPTACPPGRKDSKGELDPPE
PMRVGDLGECFFPLSSTAVSPDPENFLCEMEEIPFNPVRSWLKHDSSQAPPSPFSPDASS
PLLPMPAEFFHPAVSASQKGPEKGTGTGTLPKIALQGSWASLRSPRVNCTLLRQATGSDT
SLDASPSSSAGSLQTTLEDSLTLSDSPRRALGPPAPAPGPRAGLSPAARRRLSLRGRGLF
SLRGLRAHQRSHSSGGSTSPGCTHHDSMDPSDEEGRGGAGGGGAGSEHSETLSSLSLTSL
FCPPPPPPAPGLTPARKFSSTSSLAAPGRPHAAALAHGLARSPSWAADRSKDPPGRAPLP
MGLGPLAPPPQPLPGELEPGDAASKRKR
NT seq 6567 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagcgcctccccgccctcctcatctgcagcagccccagccgctgagccagga
gtcaccacggagcagcccggaccccggagccccccatcctccccgccaggcctggaggag
cctctggatggagctgatcctcatgtcccacacccagacctggcgcctattgccttcttc
tgcctgcgacagaccaccagcccccggaactggtgcatcaagatggtgtgcaacccgtgg
tttgaatgtgtcagcatgctggtgatcctgctgaactgcgtgacacttggcatgtaccag
ccgtgcgacgacatggactgcctgtccgaccgctgcaagatcctgcaggtctttgatgac
ttcatctttatcttctttgccatggagatggtgctcaagatggtggccctggggattttt
ggcaagaagtgctacctcggggacacatggaaccgcctggatttcttcatcgtcatggca
gggatggtcgagtactccctggaccttcagaacatcaacctgtcagccatccgcaccgtg
cgcgtcctgaggcccctcaaagccatcaaccgcgtgcccagtatgcggatcctggtgaac
ctgctcctggacacactgcccatgctggggaatgtcctgctgctctgcttctttgtcttc
ttcatctttggcatcataggtgtgcagctctgggcgggcctgctgcgtaaccgctgcttc
ctggaggagaacttcaccatacaaggggatgtggccttgcccccatactaccagccggag
gaggatgatgagatgcccttcatctgctccctgtcgggcgacaatgggataatgggctgc
catgagatccccccgctcaaggagcagggccgtgagtgctgcctgtccaaggacgacgtc
tacgactttggggcggggcgccaggacctcaatgccagcggcctctgtgtcaactggaac
cgttactacaatgtgtgccgcacgggcagcgccaacccccacaagggtgccatcaacttt
gacaacatcggttatgcttggattgtcatcttccaggtgatcactctggaaggctgggtg
gagatcatgtactacgtgatggatgctcactccttctacaacttcatctacttcatcctg
cttatcatagtgggctccttcttcatgatcaacctgtgcctcgttgtcatagcgacccag
ttctcggagaccaagcaacgggagcaccggctgatgctggagcagcggcagcgctacctg
tcctccagcacggtggccagctacgccgagcctggcgactgctacgaggagatcttccag
tatgtctgccacatcctgcgcaaggccaagcgccgcgccctgggcctctaccaggccctg
cagagccggcgccaggccctgggcccggaggccccggcccccgccaaacctgggccccac
gccaaggagccccggcactaccagctgtgcccgcaacatagccccctggatgcgacgccc
cacaccctggtgcagcccatccccgccacgctggcttccgatcccgccagctgcccttgc
tgccagcatgaggacggccggcggccctcgggcctgggcagcaccgactcgggccaggag
ggctcgggctccgggagctccgctggtggcgaggacgaggcggatggggacggggcccgg
agcagcgaggacggagcctcctcagaactggggaaggaggaggaggaggaggagcaggcg
gatggggcggtctggctgtgcggggatgtgtggcgggagacgcgagccaagctgcgcggc
atcgtggacagcaagtacttcaaccggggcatcatgatggccatcctggtcaacaccgtc
agcatgggcatcgagcaccacgagcagccggaggagctgaccaacatcctggagatctgc
aatgtggtcttcaccagcatgtttgccctggagatgatcctgaagctggctgcatttggg
ctcttcgactacctgcgtaacccctacaacatcttcgacagcatcattgtcatcatcagc
atctgggagattgtggggcaggcggacggtgggctgtcggtgctgcggaccttccggctg
ctgcgcgtgctgaaactggtgcgcttcatgcctgccctgcggcgccagctcgtggtgctc
atgaagaccatggacaacgtggccaccttctgcatgctgctcatgctcttcatcttcatc
ttcagcatccttgggatgcatatttttggctgcaagttcagcctccgcacggacactgga
gacacggtgcccgacaggaagaacttcgactccctgctgtgggccatcgtcactgtgttc
cagatcctcacccaggaggactggaacgtcgttctctacaatggcatggcctccacttct
ccctgggcctccctctactttgtcgccctcatgaccttcggcaactatgtgctcttcaac
ctgctggtggccatcctggtggagggcttccaggcggagggtgacgccaatcgctcctac
tcggacgaggaccagagctcatccaacatagaagagtttgataagctccaggaaggcctg
gacagcagcggagatcccaagctctgcccaatccccatgacccccaatgggcacctggac
cccagtctcccactgggtgggcacctaggtcctgctggggctgcgggacctgccccccga
ctctcactgcagccggaccccatgctggtggccctgggctcccgaaagagcagtgtcatg
tctctagggaggatgagctatgaccagcgctccctgtccagctcccggagctcctactac
gggccatggggccgcagcgcggcctgggccagccgtcgctccagctggaacagcctcaag
cacaagccgccgtcggcggagcatgagtccctgctctctgcggagcgcggcggcggcgcc
cgggtctgcgaggttgccgcggacgaggggccgccgcgggccgcacccctgcacacccca
cacgcccaccacattcatcacgggccccatctggcgcaccgccaccgccaccaccgccgg
acgctgtccctcgacaacagggactcggtggacctggccgagctggtgcccgcggtgggc
gcccacccccgggccgcctggagggcggcaggcccggcccccgggcatgaggactgcaat
ggcaggatgcccagcatcgccaaagacgtcttcaccaagatgggcgaccgcggggatcgc
ggggaggatgaggaggaaatcgactacaccctgtgcttccgcgtccgcaagatgatcgac
gtctataagcccgactggtgcgaggtccgcgaagactggtctgtctacctcttctctccc
gagaacaggttccgggtcctgtgtcagaccattattgcccacaaactcttcgactacgtc
gtcctggccttcatctttctcaactgcatcaccatcgccctggagcggcctcagatcgag
gccggcagcaccgaacgcatctttctcaccgtgtccaactacatcttcacggccatcttc
gtgggcgagatgacattgaaggtagtctcgctgggcctgtacttcggcgagcaggcgtac
ctacgcagcagctggaacgtgctggatggctttcttgtcttcgtgtccatcatcgacatc
gtggtgtccctggcctcagccgggggagccaagatcttgggggtcctccgagtcttgcgg
ctcctgcgcaccctacgccccctgcgtgtcatcagccgggcgccgggcctgaagctggtg
gtggagacactcatctcctccctcaagcccatcggcaacatcgtgctcatctgctgtgcc
ttcttcatcatctttggcatcctgggagtgcagctcttcaagggcaagttctaccactgt
ctgggcgtggacacccgcaacatcaccaaccgctcggactgcatggccgccaactaccgc
tgggtccatcacaaatacaacttcgacaacctgggccaggctctgatgtccctctttgtc
ctggcatccaaggatggttgggtgaacatcatgtacaatggactggatgctgttgctgtg
gaccagcagcctgtgaccaaccacaacccctggatgctgctgtacttcatctccttcctg
ctcatcgtcagcttctttgtgctcaacatgtttgtgggtgtcgtggtggagaacttccac
aagtgccggcagcaccaggaggctgaagaggcacggcggcgtgaggagaagcggctgcgg
cgcctggagaagaagcgccggaaggcccagcggctgccctactatgccacctattgtcac
acccggctgctcatccactccatgtgcaccagccactacctggacatcttcatcaccttc
atcatctgcctcaacgtggtcaccatgtccctggagcactacaatcagcccacgtccctg
gagacagccctcaagtactgcaactatatgttcaccactgtctttgtgctggaggctgtg
ctgaagctggtggcatttggtctgaggcgcttcttcaaggaccgatggaaccagctggac
ctggccattgtgctactgtcagtcatgggcatcaccctggaggagatcgagatcaatgcg
gccctgcccatcaatcccaccatcatccgcatcatgagggttctgcgcattgcccgagtg
ctgaagctgttgaagatggccacaggaatgcgggccctgctggacacggtggtgcaagct
ttgccccaggtgggcaacctgggcctcctcttcatgctgctcttcttcatctatgctgct
ctcggggtggagctctttgggaagctggtctgcaacgacgagaacccgtgcgagggcatg
agccggcatgccaccttcgagaacttcggcatggccttcctcacactcttccaggtctcc
acgggtgacaactggaacgggatcatgaaggacacgctgcgggactgcacccacgacgag
cgcagctgcctgagcagcctgcagtttgtgtcgccgctgtacttcgtgagcttcgtgctc
accgcgcagttcgtgctcatcaacgtggtggtggctgtgctcatgaagcacctggacgac
agcaacaaggaggcgcaggaggacgccgagatggatgccgagctcgagctggagatggcc
catggcctgggccctggcccgaggctgcctaccggctccccgggcgcccctggccgaggg
ccgggaggggcgggcggcgggggcgacaccgagggcggcttgtgccggcgctgctactcg
cctgcccaggagaacctgtggctggacagcgtctctttaatcatcaaggactccttggag
ggggagctgaccatcatcgacaacctgtcgggctccatcttccaccactactcctcgcct
gccggctgcaagaagtgtcaccacgacaagcaagaggtgcagctggctgagacggaggcc
ttctccctgaactcagacaggtcctcgtccatcctgctgggtgacgacctgagtctcgag
gaccccacagcctgcccacctggccgcaaagacagcaagggtgagctggacccacctgag
cccatgcgtgtgggagacctgggcgaatgcttcttccccttgtcctctacggccgtctcg
ccggatccagagaacttcctgtgtgagatggaggagatcccattcaaccctgtccggtcc
tggctgaaacatgacagcagtcaagcacccccaagtcccttctccccggatgcctccagc
cctctcctgcccatgccagccgagttcttccaccctgcagtgtctgccagccagaaaggc
ccagaaaagggcactggcactggaaccctccccaagattgcgctgcagggctcctgggca
tctctgcggtcaccaagggtcaactgtaccctcctccggcaggccaccgggagcgacacg
tcgctggacgccagccccagcagctccgcgggcagcctgcagaccacgctcgaggacagc
ctgaccctgagcgacagcccccggcgtgccctggggccgcccgcgcctgctccaggaccc
cgggccggcctgtcccccgccgctcgccgccgcctgagcctgcgcggccggggcctcttc
agcctgcgggggctgcgggcgcatcagcgcagccacagcagcgggggctccaccagcccg
ggctgcacccaccacgactccatggacccctcggacgaggagggccgcggtggcgcgggc
ggcgggggcgcgggcagcgagcactcggagaccctcagcagcctctcgctcacctccctc
ttctgcccgccgcccccgccgccagcccccggcctcacgcccgccaggaagttcagcagc
accagcagcctggccgcccccggccgcccccacgccgccgccctggcccacggcctggcc
cggagcccctcgtgggccgcggaccgcagcaaggacccccccggccgggcaccgctgccc
atgggcctgggccccttggcgcccccgccgcaaccgctccccggagagctggagccggga
gacgccgccagcaagaggaagagatga

DBGET integrated database retrieval system