KEGG   Homo sapiens (human): 8913Help
Entry
8913              CDS       T01001                                 

Gene name
CACNA1G, Ca(V)T.1, Cav3.1, NBR13
Definition
calcium channel, voltage-dependent, T type, alpha 1G subunit
Orthology
K04854  
voltage-dependent calcium channel T type alpha-1G
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Circadian entrainment
Type II diabetes mellitus
Drug target
Mibefradil: 
Bepridil: 
Ethosuximide: 
Valproic acid: 
Zonisamide: 
Penfluridol: 
Flunarizine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    8913 (CACNA1G)
   04020 Calcium signaling pathway
    8913 (CACNA1G)
 Organismal Systems
  Environmental adaptation
   04713 Circadian entrainment
    8913 (CACNA1G)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    8913 (CACNA1G)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-1, CaVx.x
   8913 (CACNA1G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q22
AA seq 2314 aa AA seqDB search
MDEEEDGAGAEESGQPRSFMRLNDLSGAGGRPGPGSAEKDPGSADSEAEGLPYPALAPVV
FFYLSQDSRPRSWCLRTVCNPWFERISMLVILLNCVTLGMFRPCEDIACDSQRCRILQAF
DDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVR
TVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNR
CFLPENFSLPLSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLRGDGGGGPPCGL
DYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEGWVDIM
YFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNA
STLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQPSS
SCSRSHRRLSVHHLVHHHHHHHHHYHLGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTP
ALSGAPPGGAESVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPE
TLKEKALVEVAASSGPPTLTSLNIPPGPYSSMHKLLETQSTGACQSSCKISSPCLKADSG
ACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQHSDLRDPHSRRQRSLGPDA
EPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNALEISNI
VFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLMR
VLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTL
PDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLLV
AILVEGFQAEEISKREDASGQLSCIQLPVDSQGGDANKSESEPDFFSPSLDGDGDRKKCL
ALVSLGEHPELRKSLLPPLIIHTAATPMSLPKSTSTGLGEALGPASRRTSSSGSAEPGAA
HEMKSPPSARSSPHSPWSAASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGQESQ
DEEESSEEERASPAGSDHRHRGSLEREAKSSFDLPDTLQVPGLHRTASGRGSASEHQDCN
GKSASGRLARALRPDDPPLDGDDADDEGNLSKGERVRAWIRARLPACCLERDSWSAYIFP
PQSRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNYIFTAV
FLAEMTVKVVALGWCFGEQAYLRSSWNVLDGLLVLISVIDILVSMVSDSGTKILGMLRVL
RLLRTLRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFV
CQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVG
VDQQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRL
RRLEKKRRKAQCKPYYSDYSRFRLLVHHLCTSHYLDLFITGVIGLNVVTMAMEHYQQPQI
LDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDLAIVLLSIMGITLEEIEVN
ASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQALPQVGNLGLLFMLLFFIFA
ALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFRVSTGDNWNGIMKDTLRDCDQE
STCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKEAKEEAELEAELELEMKTL
SPQPHSPLGSPFLWPGVEGPDSPDSPKPGALHPAAHARSASHFSLEHPTDRQLFDTISLL
IQGSLEWELKLMDELAGPGGQPSAFPSAPSLGGSDPQMQPHPTELPGPDLLTVRKSGVSR
THSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTSYILQLPKDAPHLL
QPHSAPTWGTIPKLPPPGRSPLAQRPLRRQAAIRTDSLDVQGLGSREDLLAEVSGPSPPL
ARAYSFWGQSSTQAQQHSRSHSKISKHMTPPAPCPGPEPNWGKGPPETRSSLELDTELSW
ISGDLLPPGGQEEPPSPRDLKKCYSVEAQSCQRRPTSWLDEQRRHSIAVSCLDSGSQPHL
GTDPSNLGGQPLGGPGSRPKKKLSPPSITIDPPESQGPRTPPSPGICLRRRAPSSDSKDP
LASGPPDSMAASPSPKKDVLSLSGLSSDPADLDP
NT seq 6945 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggaggaggatggagcgggcgccgaggagtcgggacagccccggagcttcatg
cggctcaacgacctgtcgggggccgggggccggccggggccggggtcagcagaaaaggac
ccgggcagcgcggactccgaggcggaggggctgccgtacccggcgctggccccggtggtt
ttcttctacttgagccaggacagccgcccgcggagctggtgtctccgcacggtctgtaac
ccctggtttgagcgcatcagcatgttggtcatccttctcaactgcgtgaccctgggcatg
ttccggccatgcgaggacatcgcctgtgactcccagcgctgccggatcctgcaggccttt
gatgacttcatctttgccttctttgccgtggagatggtggtgaagatggtggccttgggc
atctttgggaaaaagtgttacctgggagacacttggaaccggcttgactttttcatcgtc
atcgcagggatgctggagtactcgctggacctgcagaacgtcagcttctcagctgtcagg
acagtccgtgtgctgcgaccgctcagggccattaaccgggtgcccagcatgcgcatcctt
gtcacgttgctgctggatacgctgcccatgctgggcaacgtcctgctgctctgcttcttc
gtcttcttcatcttcggcatcgtcggcgtccagctgtgggcagggctgcttcggaaccga
tgcttcctacctgagaatttcagcctccccctgagcgtggacctggagcgctattaccag
acagagaacgaggatgagagccccttcatctgctcccagccacgcgagaacggcatgcgg
tcctgcagaagcgtgcccacgctgcgcggggacgggggcggtggcccaccttgcggtctg
gactatgaggcctacaacagctccagcaacaccacctgtgtcaactggaaccagtactac
accaactgctcagcgggggagcacaaccccttcaagggcgccatcaactttgacaacatt
ggctatgcctggatcgccatcttccaggtcatcacgctggagggctgggtcgacatcatg
tactttgtgatggatgctcattccttctacaatttcatctacttcatcctcctcatcatc
gtgggctccttcttcatgatcaacctgtgcctggtggtgattgccacgcagttctcagag
accaagcagcgggaaagccagctgatgcgggagcagcgtgtgcggttcctgtccaacgcc
agcaccctggctagcttctctgagcccggcagctgctatgaggagctgctcaagtacctg
gtgtacatccttcgtaaggcagcccgcaggctggctcaggtctctcgggcagcaggtgtg
cgggttgggctgctcagcagcccagcacccctcgggggccaggagacccagcccagcagc
agctgctctcgctcccaccgccgcctatccgtccaccacctggtgcaccaccaccaccac
catcaccaccactaccacctgggcaatgggacgctcagggccccccgggccagcccggag
atccaggacagggatgccaatgggtcccgccggctcatgctgccaccaccctcgacgcct
gccctctccggggccccccctggtggcgcagagtctgtgcacagcttctaccatgccgac
tgccacttagagccagtccgctgccaggcgccccctcccaggtccccatctgaggcatcc
ggcaggactgtgggcagcgggaaggtgtatcccaccgtgcacaccagccctccaccggag
acgctgaaggagaaggcactagtagaggtggctgccagctctgggcccccaaccctcacc
agcctcaacatcccacccgggccctacagctccatgcacaagctgctggagacacagagt
acaggtgcctgccaaagctcttgcaagatctccagcccttgcttgaaagcagacagtgga
gcctgtggtccagacagctgcccctactgtgcccgggccggggcaggggaggtggagctc
gccgaccgtgaaatgcctgactcagacagcgaggcagtttatgagttcacacaggatgcc
cagcacagcgacctccgggacccccacagccggcggcaacggagcctgggcccagatgca
gagcccagctctgtgctggccttctggaggctaatctgtgacaccttccgaaagattgtg
gacagcaagtactttggccggggaatcatgatcgccatcctggtcaacacactcagcatg
ggcatcgaataccacgagcagcccgaggagcttaccaacgccctagaaatcagcaacatc
gtcttcaccagcctctttgccctggagatgctgctgaagctgcttgtgtatggtcccttt
ggctacatcaagaatccctacaacatcttcgatggtgtcattgtggtcatcagcgtgtgg
gagatcgtgggccagcaggggggcggcctgtcggtgctgcggaccttccgcctgatgcgt
gtgctgaagctggtgcgcttcctgccggcgctgcagcggcagctggtggtgctcatgaag
accatggacaacgtggccaccttctgcatgctgcttatgctcttcatcttcatcttcagc
atcctgggcatgcatctcttcggctgcaagtttgcctctgagcgggatggggacaccctg
ccagaccggaagaattttgactccttgctctgggccatcgtcactgtctttcagatcctg
acccaggaggactggaacaaagtcctctacaatggtatggcctccacgtcgtcctgggcg
gccctttatttcattgccctcatgaccttcggcaactacgtgctcttcaatttgctggtc
gccattctggtggagggcttccaggcggaggaaatcagcaaacgggaagatgcgagtgga
cagttaagctgtattcagctgcctgtcgactcccaggggggagatgccaacaagtccgaa
tcagagcccgatttcttctcacccagcctggatggtgatggggacaggaagaagtgcttg
gccttggtgtccctgggagagcacccggagctgcggaagagcctgctgccgcctctcatc
atccacacggccgccacacccatgtcgctgcccaagagcaccagcacgggcctgggcgag
gcgctgggccctgcgtcgcgccgcaccagcagcagcgggtcggcagagcctggggcggcc
cacgagatgaagtcaccgcccagcgcccgcagctctccgcacagcccctggagcgctgca
agcagctggaccagcaggcgctccagccggaacagcctcggccgtgcacccagcctgaag
cggagaagcccaagtggagagcggcggtccctgttgtcgggagaaggccaggagagccag
gatgaagaggagagctcagaagaggagcgggccagccctgcgggcagtgaccatcgccac
agggggtccctggagcgggaggccaagagttcctttgacctgccagacacactgcaggtg
ccagggctgcatcgcactgccagtggccgagggtctgcttctgagcaccaggactgcaat
ggcaagtcggcttcagggcgcctggcccgggccctgcggcctgatgaccccccactggat
ggggatgacgccgatgacgagggcaacctgagcaaaggggaacgggtccgcgcgtggatc
cgagcccgactccctgcctgctgcctcgagcgagactcctggtcagcctacatcttccct
cctcagtccaggttccgcctcctgtgtcaccggatcatcacccacaagatgttcgaccac
gtggtccttgtcatcatcttccttaactgcatcaccatcgccatggagcgccccaaaatt
gacccccacagcgctgaacgcatcttcctgaccctctccaattacatcttcaccgcagtc
tttctggctgaaatgacagtgaaggtggtggcactgggctggtgcttcggggagcaggcg
tacctgcggagcagttggaacgtgctggacgggctgttggtgctcatctccgtcatcgac
attctggtgtccatggtctctgacagcggcaccaagatcctgggcatgctgagggtgctg
cggctgctgcggaccctgcgcccgctcagggtgatcagccgggcgcaggggctgaagctg
gtggtggagacgctgatgtcctcactgaaacccatcggcaacattgtagtcatctgctgt
gccttcttcatcattttcggcatcttgggggtgcagctcttcaaagggaagtttttcgtg
tgccagggcgaggataccaggaacatcaccaataaatcggactgtgccgaggccagttac
cggtgggtccggcacaagtacaactttgacaaccttggccaggccctgatgtccctgttc
gttttggcctccaaggatggttgggtggacatcatgtacgatgggctggatgctgtgggc
gtggaccagcagcccatcatgaaccacaacccctggatgctgctgtacttcatctcgttc
ctgctcattgtggccttctttgtcctgaacatgtttgtgggtgtggtggtggagaacttc
cacaagtgtcggcagcaccaggaggaagaggaggcccggcggcgggaggagaagcgccta
cgaagactggagaaaaagagaaggaaagcccagtgcaaaccttactactccgactactcc
cgcttccggctcctcgtccaccacttgtgcaccagccactacctggacctcttcatcaca
ggtgtcatcgggctgaacgtggtcaccatggccatggagcactaccagcagccccagatt
ctggatgaggctctgaagatctgcaactacatcttcactgtcatctttgtcttggagtca
gttttcaaacttgtggcctttggtttccgtcggttcttccaggacaggtggaaccagctg
gacctggccattgtgctgctgtccatcatgggcatcacgctggaggaaatcgaggtcaac
gcctcgctgcccatcaaccccaccatcatccgcatcatgagggtgctgcgcattgcccga
gtgctgaagctgctgaagatggctgtgggcatgcgggcgctgctggacacggtgatgcag
gccctgccccaggtggggaacctgggacttctcttcatgttgttgtttttcatctttgca
gctctgggcgtggagctctttggagacctggagtgtgacgagacacacccctgtgagggc
ctgggccgtcatgccacctttcggaactttggcatggccttcctaaccctcttccgagtc
tccacaggtgacaattggaatggcattatgaaggacaccctccgggactgtgaccaggag
tccacctgctacaacacggtcatctcgcctatctactttgtgtccttcgtgctgacggcc
cagttcgtgctagtcaacgtggtgatcgccgtgctgatgaagcacctggaggagagcaac
aaggaggccaaggaggaggccgagctagaggctgagctggagctggagatgaagaccctc
agcccccagccccactcgccactgggcagccccttcctctggcctggggtcgagggcccc
gacagccccgacagccccaagcctggggctctgcacccagcggcccacgcgagatcagcc
tcccacttttccctggagcaccccacggacaggcagctgtttgacaccatatccctgctg
atccagggctccctggagtgggagctgaagctgatggacgagctggcaggcccagggggc
cagccctctgccttcccttctgcccccagcctgggaggctccgacccacagatgcagccc
caccccacggagctgccaggaccagacttactgactgtgcggaagtctggggtcagccga
acgcactctctgcccaatgacagctacatgtgtcggcatgggagcactgccgaggggccc
ctgggacacaggggctgggggctccccaaagctcagtcaggctccgtcttgtccgttcac
tcccagccagcagataccagctacatcctgcagcttcccaaagatgcacctcatctgctc
cagccccacagcgccccaacctggggcaccatccccaaactgcccccaccaggacgctcc
cctttggctcagaggccactcaggcgccaggcagcaataaggactgactccttggacgtt
cagggtctgggcagccgggaagacctgctggcagaggtgagtgggccctccccgcccctg
gcccgggcctactctttctggggccagtcaagtacccaggcacagcagcactcccgcagc
cacagcaagatctccaagcacatgaccccgccagccccttgcccaggcccagaacccaac
tggggcaagggccctccagagaccagaagcagcttagagttggacacggagctgagctgg
atttcaggagacctcctgccccctggcggccaggaggagcccccatccccacgggacctg
aagaagtgctacagcgtggaggcccagagctgccagcgccggcctacgtcctggctggat
gagcagaggagacactctatcgccgtcagctgcctggacagcggctcccaaccccacctg
ggcacagacccctctaaccttgggggccagcctcttggggggcctgggagccggcccaag
aaaaaactcagcccgcctagtatcaccatagacccccccgagagccaaggtcctcggacc
ccgcccagccctggtatctgcctccggaggagggctccgtccagcgactccaaggatccc
ttggcctctggcccccctgacagcatggctgcctcgccctccccaaagaaagatgtgctg
agtctctccggtttatcctctgacccagcagacctggacccctga

DBGET integrated database retrieval system