KEGG   Homo sapiens (human): 8942Help
Entry
8942              CDS       T01001                                 

Gene name
KYNU
Definition
kynureninase (EC:3.7.1.3)
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    8942 (KYNU)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     8942 (KYNU)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q22.2
AA seq 307 aa AA seqDB search
MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLS
LVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLM
KDIVGANEKEIALMNALTVNLHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHG
LNIEESMRMIKPREGEETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFNIPAITKAG
QAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP
ARSEFFN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggagccttcatctcttgagctgccggctgacacagtgcagcgcattgcggctgaactc
aaatgccacccaacggatgagagggtggctctccacctagatgaggaagataagctgagg
cacttcagggagtgcttttatattcccaaaatacaggatctgcctccagttgatttatca
ttagtgaataaagatgaaaatgccatctatttcttgggaaattctcttggccttcaacca
aaaatggttaaaacatatcttgaagaagaactagataagtgggccaaaatagcagcctat
ggtcatgaagtggggaagcgtccttggattacaggagatgagagtattgtaggccttatg
aaggacattgtaggagccaatgagaaagaaatagccctaatgaatgctttgactgtaaat
ttacatcttctaatgttatcattttttaagcctacgccaaaacgatataaaattcttcta
gaagccaaagccttcccttctgatcattatgctattgagtcacaactacaacttcacgga
cttaacattgaagaaagtatgcggatgataaagccaagagagggggaagaaaccttaaga
atagaggatatccttgaagtaattgagaaggaaggagactcaattgcagtgatcctgttc
agtggggtgcatttttacactggacagcactttaatattcctgccatcacaaaagctgga
caagcgaagggttgttatgttggctttgatctagcacatgcagttggaaatgttgaactc
tacttacatgactggggagttgattttgcctgctggtgttcctacaagtatttaaatgca
ggagcaggaggaattgctggtgccttcattcatgaaaagcatgcccatacgattaaacct
gcgagatcggagttctttaattag

DBGET integrated database retrieval system