KEGG   Homo sapiens (human): 8945Help
Entry
8945              CDS       T01001                                 

Gene name
BTRC, BETA-TRCP, FBW1A, FBXW1, FBXW1A, FWD1, bTrCP, bTrCP1, betaTrCP
Definition
beta-transducin repeat containing E3 ubiquitin protein ligase
Orthology
K03362  
F-box and WD-40 domain protein 1/11
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Ubiquitin mediated proteolysis
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Circadian rhythm
Shigellosis
Module
SCF-BTRC complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8945 (BTRC)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    8945 (BTRC)
   04340 Hedgehog signaling pathway
    8945 (BTRC)
   04390 Hippo signaling pathway
    8945 (BTRC)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    8945 (BTRC)
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    8945 (BTRC)
 Human Diseases
  Infectious diseases
   05131 Shigellosis
    8945 (BTRC)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    target recognizing subunit (F-box)
     8945 (BTRC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q24.32
AA seq 579 aa AA seqDB search
MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQTYNSCARL
CLNQETVCLASTAMKTENCVAKTKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQWSE
SDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLC
AAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPPNS
FYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIK
IWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAV
LHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDR
TIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHE
ELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEF
QIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggacccggccgaggcggtgctgcaagagaaggcactcaagtttatgtgctctatgccc
aggtctctgtggctgggctgctccagcctggcggacagcatgccttcgctgcgatgcctg
tataacccagggactggcgcactcacagctttccagacatacaacagctgtgccagactc
tgcttaaaccaagaaacagtatgtttagcaagcactgctatgaagactgagaattgtgtg
gccaaaacaaaacttgccaatggcacttccagtatgattgtgcccaagcaacggaaactc
tcagcaagctatgaaaaggaaaaggaactgtgtgtcaaatactttgagcagtggtcagag
tcagatcaagtggaatttgtggaacatcttatatcccaaatgtgtcattaccaacatggg
cacataaactcgtatcttaaacctatgttgcagagagatttcataactgctctgccagct
cggggattggatcatattgctgagaacattctgtcatacctggatgccaaatcactatgt
gctgctgaacttgtgtgcaaggaatggtaccgagtgacctctgatggcatgctgtggaag
aagcttatcgagagaatggtcaggacagattctctgtggagaggcctggcagaacgaaga
ggatggggacagtatttattcaaaaacaaacctcctgacgggaatgctcctcccaactct
ttttatagagcactttatcctaaaattatacaagacattgagacaatagaatctaattgg
agatgtggaagacatagtttacagagaattcactgccgaagtgaaacaagcaaaggagtt
tactgtttacagtatgatgatcagaaaatagtaagcggccttcgagacaacacaatcaag
atctgggataaaaacacattggaatgcaagcgaattctcacaggccatacaggttcagtc
ctctgtctccagtatgatgagagagtgatcataacaggatcatcggattccacggtcaga
gtgtgggatgtaaatacaggtgaaatgctaaacacgttgattcaccattgtgaagcagtt
ctgcacttgcgtttcaataatggcatgatggtgacctgctccaaagatcgttccattgct
gtatgggatatggcctccccaactgacattaccctccggagggtgctggtcggacaccga
gctgctgtcaatgttgtagactttgatgacaagtacattgtttctgcatctggggataga
actataaaggtatggaacacaagtacttgtgaatttgtaaggaccttaaatggacacaaa
cgaggcattgcctgtttgcagtacagggacaggctggtagtgagtggctcatctgacaac
actatcagattatgggacatagaatgtggtgcatgtttacgagtgttagaaggccatgag
gaattggtgcgttgtattcgatttgataacaagaggatagtcagtggggcctatgatgga
aaaattaaagtgtgggatcttgtggctgctttggacccccgtgctcctgcagggacactc
tgtctacggacccttgtggagcattccggaagagtttttcgactacagtttgatgaattc
cagattgtcagtagttcacatgatgacacaatcctcatctgggacttcctaaatgatcca
gctgcccaagctgaacccccccgttccccttctcgaacatacacctacatctccagataa

DBGET integrated database retrieval system