KEGG   Homo sapiens (human): 8945Help
Entry
8945              CDS       T01001                                 

Gene name
BTRC, BETA-TRCP, FBW1A, FBXW1, FBXW1A, FWD1, bTrCP, bTrCP1, betaTrCP
Definition
beta-transducin repeat containing E3 ubiquitin protein ligase
Orthology
K03362  
F-box and WD-40 domain protein 1/11
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Ubiquitin mediated proteolysis
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Circadian rhythm
Shigellosis
Module
SCF-BTRC complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:hsa04340]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:hsa04710]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q24.32
AA seq 579 aa AA seqDB search
MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQTYNSCARL
CLNQETVCLASTAMKTENCVAKTKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQWSE
SDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLC
AAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPPNS
FYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIK
IWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAV
LHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDR
TIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHE
ELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEF
QIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggacccggccgaggcggtgctgcaagagaaggcactcaagtttatgtgctctatgccc
aggtctctgtggctgggctgctccagcctggcggacagcatgccttcgctgcgatgcctg
tataacccagggactggcgcactcacagctttccagacatacaacagctgtgccagactc
tgcttaaaccaagaaacagtatgtttagcaagcactgctatgaagactgagaattgtgtg
gccaaaacaaaacttgccaatggcacttccagtatgattgtgcccaagcaacggaaactc
tcagcaagctatgaaaaggaaaaggaactgtgtgtcaaatactttgagcagtggtcagag
tcagatcaagtggaatttgtggaacatcttatatcccaaatgtgtcattaccaacatggg
cacataaactcgtatcttaaacctatgttgcagagagatttcataactgctctgccagct
cggggattggatcatattgctgagaacattctgtcatacctggatgccaaatcactatgt
gctgctgaacttgtgtgcaaggaatggtaccgagtgacctctgatggcatgctgtggaag
aagcttatcgagagaatggtcaggacagattctctgtggagaggcctggcagaacgaaga
ggatggggacagtatttattcaaaaacaaacctcctgacgggaatgctcctcccaactct
ttttatagagcactttatcctaaaattatacaagacattgagacaatagaatctaattgg
agatgtggaagacatagtttacagagaattcactgccgaagtgaaacaagcaaaggagtt
tactgtttacagtatgatgatcagaaaatagtaagcggccttcgagacaacacaatcaag
atctgggataaaaacacattggaatgcaagcgaattctcacaggccatacaggttcagtc
ctctgtctccagtatgatgagagagtgatcataacaggatcatcggattccacggtcaga
gtgtgggatgtaaatacaggtgaaatgctaaacacgttgattcaccattgtgaagcagtt
ctgcacttgcgtttcaataatggcatgatggtgacctgctccaaagatcgttccattgct
gtatgggatatggcctccccaactgacattaccctccggagggtgctggtcggacaccga
gctgctgtcaatgttgtagactttgatgacaagtacattgtttctgcatctggggataga
actataaaggtatggaacacaagtacttgtgaatttgtaaggaccttaaatggacacaaa
cgaggcattgcctgtttgcagtacagggacaggctggtagtgagtggctcatctgacaac
actatcagattatgggacatagaatgtggtgcatgtttacgagtgttagaaggccatgag
gaattggtgcgttgtattcgatttgataacaagaggatagtcagtggggcctatgatgga
aaaattaaagtgtgggatcttgtggctgctttggacccccgtgctcctgcagggacactc
tgtctacggacccttgtggagcattccggaagagtttttcgactacagtttgatgaattc
cagattgtcagtagttcacatgatgacacaatcctcatctgggacttcctaaatgatcca
gctgcccaagctgaacccccccgttccccttctcgaacatacacctacatctccagataa

DBGET integrated database retrieval system