KEGG   Homo sapiens (human): 896Help
Entry
896               CDS       T01001                                 

Gene name
CCND3
Definition
cyclin D3
Orthology
K10152  
cyclin D3
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Focal adhesion
Jak-STAT signaling pathway
Measles
HTLV-I infection
Viral carcinogenesis
Disease
H00010  
Multiple myeloma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    896 (CCND3)
   04390 Hippo signaling pathway
    896 (CCND3)
   04630 Jak-STAT signaling pathway
    896 (CCND3)
   04151 PI3K-Akt signaling pathway
    896 (CCND3)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    896 (CCND3)
   04115 p53 signaling pathway
    896 (CCND3)
  Cell communication
   04510 Focal adhesion
    896 (CCND3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    896 (CCND3)
  Infectious diseases
   05166 HTLV-I infection
    896 (CCND3)
   05162 Measles
    896 (CCND3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21
AA seq 211 aa AA seqDB search
MNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWE
VLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPS
MIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQT
SSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaactacctggatcgctacctgtcttgcgtccccacccgaaaggcgcagttgcagctc
ctgggtgcggtctgcatgctgctggcctccaagctgcgcgagaccacgcccctgaccatc
gaaaaactgtgcatctacaccgaccacgctgtctctccccgccagttgcgggactgggag
gtgctggtcctagggaagctcaagtgggacctggctgctgtgattgcacatgatttcctg
gccttcattctgcaccggctctctctgccccgtgaccgacaggccttggtcaaaaagcat
gcccagacctttttggccctctgtgctacagattatacctttgccatgtacccgccatcc
atgatcgccacgggcagcattggggctgcagtgcaaggcctgggtgcctgctccatgtcc
ggggatgagctcacagagctgctggcagggatcactggcactgaagtggactgcctgcgg
gcctgtcaggagcagatcgaagctgcactcagggagagcctcagggaagcctctcagacc
agctccagcccagcgcccaaagccccccggggctccagcagccaagggcccagccagacc
agcactcctacagatgtcacagccatacacctgtag

DBGET integrated database retrieval system