KEGG   Homo sapiens (human): 896Help
Entry
896               CDS       T01001                                 

Gene name
CCND3
Definition
(RefSeq) cyclin D3
  KO
K10152  
cyclin D3
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Focal adhesion
Jak-STAT signaling pathway
Measles
HTLV-I infection
Viral carcinogenesis
Module
Cell cycle - G1/S transition
Disease
H00010  
Multiple myeloma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    896 (CCND3)
   04390 Hippo signaling pathway
    896 (CCND3)
   04630 Jak-STAT signaling pathway
    896 (CCND3)
   04151 PI3K-Akt signaling pathway
    896 (CCND3)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    896 (CCND3)
   04115 p53 signaling pathway
    896 (CCND3)
  Cellular community - eukaryotes
   04510 Focal adhesion
    896 (CCND3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    896 (CCND3)
  Infectious diseases
   05166 HTLV-I infection
    896 (CCND3)
   05162 Measles
    896 (CCND3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P30281(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.1
AA seq 292 aa AA seqDB search
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKML
AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLT
IEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKK
HAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCL
RACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctgtgttgcgaaggcacccggcacgcgccccgggccgggccggacccgcgg
ctgctgggggaccagcgtgtcctgcagagcctgctccgcctggaggagcgctacgtaccc
cgcgcctcctacttccagtgcgtgcagcgggagatcaagccgcacatgcggaagatgctg
gcttactggatgctggaggtatgtgaggagcagcgctgtgaggaggaagtcttccccctg
gccatgaactacctggatcgctacctgtcttgcgtccccacccgaaaggcgcagttgcag
ctcctgggtgcggtctgcatgctgctggcctccaagctgcgcgagaccacgcccctgacc
atcgaaaaactgtgcatctacaccgaccacgctgtctctccccgccagttgcgggactgg
gaggtgctggtcctagggaagctcaagtgggacctggctgctgtgattgcacatgatttc
ctggccttcattctgcaccggctctctctgccccgtgaccgacaggccttggtcaaaaag
catgcccagacctttttggccctctgtgctacagattatacctttgccatgtacccgcca
tccatgatcgccacgggcagcattggggctgcagtgcaaggcctgggtgcctgctccatg
tccggggatgagctcacagagctgctggcagggatcactggcactgaagtggactgcctg
cgggcctgtcaggagcagatcgaagctgcactcagggagagcctcagggaagcctctcag
accagctccagcccagcgcccaaagccccccggggctccagcagccaagggcccagccag
accagcactcctacagatgtcacagccatacacctgtag

DBGET integrated database retrieval system