KEGG   Homo sapiens (human): 8969Help
Entry
8969              CDS       T01001                                 

Gene name
HIST1H2AG, H2A.1b, H2A/p, H2AFP, H2AG, pH2A/f
Definition
histone cluster 1, H2ag
Orthology
K11251  
histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    8969 (HIST1H2AG)
  Substance dependence
   05034 Alcoholism
    8969 (HIST1H2AG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8969 (HIST1H2AG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
6p22.1
AA seq 130 aa AA seqDB search
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtctggacgtggcaagcagggaggcaaagcccgcgctaaggccaagactcgctcttct
agggccggtctccagttccccgtgggccgagtgcaccgcctgctccgcaaaggcaactat
gccgagcgggtcggggccggcgcgccggtgtatctggcagcggtgctggagtacctgacc
gccgagatcctggaactggcgggcaacgcggcccgcgacaacaagaagacccgcatcatc
ccgcgtcatctccaactggccatccgcaacgacgaggagctcaacaagctgctgggcaaa
gtcaccatcgcacagggcggtgtcctgcccaacattcaggccgtgctactgcccaaaaag
actgagagccaccacaaggcgaagggcaagtaa

DBGET integrated database retrieval system