KEGG   Homo sapiens (human): 8969Help
Entry
8969              CDS       T01001                                 

Gene name
HIST1H2AG, H2A.1b, H2A/p, H2AFP, H2AG, pH2A/f
Definition
histone cluster 1, H2ag
Orthology
K11251  
histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Systemic lupus erythematosus
Class
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
6p22.1
AA seq 130 aa AA seqDB search
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtctggacgtggcaagcagggaggcaaagcccgcgctaaggccaagactcgctcttct
agggccggtctccagttccccgtgggccgagtgcaccgcctgctccgcaaaggcaactat
gccgagcgggtcggggccggcgcgccggtgtatctggcagcggtgctggagtacctgacc
gccgagatcctggaactggcgggcaacgcggcccgcgacaacaagaagacccgcatcatc
ccgcgtcatctccaactggccatccgcaacgacgaggagctcaacaagctgctgggcaaa
gtcaccatcgcacagggcggtgtcctgcccaacattcaggccgtgctactgcccaaaaag
actgagagccaccacaaggcgaagggcaagtaa

DBGET integrated database retrieval system