KEGG   Homo sapiens (human): 8976Help
Entry
8976              CDS       T01001                                 

Gene name
WASL, N-WASP, NWASP
Definition
Wiskott-Aldrich syndrome-like
Orthology
K05747  
Wiskott-Aldrich syndrome protein
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
Adherens junction
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    8976 (WASL)
  Cell communication
   04520 Adherens junction
    8976 (WASL)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    8976 (WASL)
   04062 Chemokine signaling pathway
    8976 (WASL)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    8976 (WASL)
   05132 Salmonella infection
    8976 (WASL)
   05131 Shigellosis
    8976 (WASL)
   05100 Bacterial invasion of epithelial cells
    8976 (WASL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q31.3
AA seq 505 aa AA seqDB search
MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKK
CSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALN
FANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVN
NISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCG
ISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPP
PPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPP
PPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTTAGNKAALLDQIREGAQLK
KVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRSK
AIHSSDEDEDEDDEEDFEDDDEWED
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgtccagcagcagccgccgccgccgcggagggtcaccaacgtggggtccctg
ttgctcaccccgcaggagaacgagtccctcttcactttcctcggcaagaaatgtgtgact
atgtcttcagcagtggtgcagttatatgcagcagatcggaactgtatgtggtcaaagaag
tgcagtggtgttgcttgtcttgttaaggacaatccacagagatcttattttttaagaata
tttgacattaaggatgggaaactattgtgggaacaagagctatacaataactttgtatat
aatagtcctagaggatattttcatacctttgctggagatacttgtcaagttgctcttaat
tttgccaatgaagaagaagcaaaaaaatttcgaaaagcagttacagaccttttgggccgt
cgacaaaggaaatctgagaaaagacgagatcccccaaatggtcctaatctacccatggct
acagttgatataaaaaatccagaaatcacaacaaatagattttatggtccacaagtcaac
aacatctcccataccaaagaaaagaagaagggaaaagctaaaaagaagagattaaccaag
gcagatataggaacaccaagcaatttccagcacattggacatgttggttgggatccaaat
acaggctttgatctgaataatttggatccagaattgaagaatcttttcgatatgtgtgga
atctcagaggcacaacttaaagacagagaaacatcaaaagttatatatgactttattgaa
aaaacaggaggtgttgaagctgttaaaaatgaactgcggaggcaagcaccaccacctcca
ccaccatcaaggggagggccacctcctcctcctccccctccacacaactcaggtcctcct
cctcctcctgctaggggaagaggcgctcctcccccaccaccttcaagagctcccacagct
gcacctccaccaccgcctccttccaggccaagtgtagcagtccctccaccaccgccaaat
aggatgtaccctcctccacctccagcccttccctcctcagcaccttcagggcctccacca
ccacctccatctgtgttgggggtagggccagtggcaccacccccaccgcctccacctcca
cctcctcctgggccaccgcccccgcctggcctgccttctgatggggaccatcaggttcca
actactgcaggaaacaaagcagctcttttagatcaaattagagagggtgctcagctaaaa
aaagtggagcagaacagtcggccagtgtcctgctctggacgagatgcactgttagaccag
atacgacagggtatccaactaaaatctgtggctgatggccaagagtctacaccaccaaca
cctgcacccacttcaggaattgtgggtgcattaatggaagtgatgcagaaaaggagcaaa
gccattcattcttcagatgaagatgaagatgaagatgatgaagaagattttgaggatgat
gatgagtgggaagactga

DBGET integrated database retrieval system