KEGG   Homo sapiens (human): 898Help
Entry
898               CDS       T01001                                 

Gene name
CCNE1, CCNE
Definition
cyclin E1
Orthology
K06626  
cyclin E
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
p53 signaling pathway
PI3K-Akt signaling pathway
Hepatitis B
Measles
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Prostate cancer
Small cell lung cancer
Disease
H00018  
Gastric cancer
H00055  
Laryngeal cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Cancers; Prostate cancer [PATH:hsa05215]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q12
AA seq 410 aa AA seqDB search
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQ
PWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM
LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR
LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA
ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI
QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgccgagggagcgcagggagcgggatgcgaaggagcgggacaccatgaaggaggacggc
ggcgcggagttctcggctcgctccaggaagaggaaggcaaacgtgaccgtttttttgcag
gatccagatgaagaaatggccaaaatcgacaggacggcgagggaccagtgtgggagccag
ccttgggacaataatgcagtctgtgcagacccctgctccctgatccccacacctgacaaa
gaagatgatgaccgggtttacccaaactcaacgtgcaagcctcggattattgcaccatcc
agaggctccccgctgcctgtactgagctgggcaaatagagaggaagtctggaaaatcatg
ttaaacaaggaaaagacatacttaagggatcagcactttcttgagcaacaccctcttctg
cagccaaaaatgcgagcaattcttctggattggttaatggaggtgtgtgaagtctataaa
cttcacagggagaccttttacttggcacaagatttctttgaccggtatatggcgacacaa
gaaaatgttgtaaaaactcttttacagcttattgggatttcatctttatttattgcagcc
aaacttgaggaaatctatcctccaaagttgcaccagtttgcgtatgtgacagatggagct
tgttcaggagatgaaattctcaccatggaattaatgattatgaaggcccttaagtggcgt
ttaagtcccctgactattgtgtcctggctgaatgtatacatgcaggttgcatatctaaat
gacttacatgaagtgctactgccgcagtatccccagcaaatctttatacagattgcagag
ctgttggatctctgtgtcctggatgttgactgccttgaatttccttatggtatacttgct
gcttcggccttgtatcatttctcgtcatctgaattgatgcaaaaggtttcagggtatcag
tggtgcgacatagagaactgtgtcaagtggatggttccatttgccatggttataagggag
acggggagctcaaaactgaagcacttcaggggcgtcgctgatgaagatgcacacaacata
cagacccacagagacagcttggatttgctggacaaagcccgagcaaagaaagccatgttg
tctgaacaaaatagggcttctcctctccccagtgggctcctcaccccgccacagagcggt
aagaagcagagcagcgggccggaaatggcgtga

DBGET integrated database retrieval system