KEGG   Homo sapiens (human): 898Help
Entry
898               CDS       T01001                                 

Gene name
CCNE1, CCNE, pCCNE1
Definition
(RefSeq) cyclin E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04115  p53 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04934  Cushing's syndrome
hsa05161  Hepatitis B
hsa05162  Measles
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05215  Prostate cancer
hsa05222  Small cell lung cancer
hsa05226  Gastric cancer
Module
hsa_M00692  Cell cycle - G1/S transition
Network
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00093  Loss of CDKN1B to p27-cell cycle G1/S
N00255  Amplified CCNE to cell cycle G1/S
N00267  HBV HBx to host-cell-protein activation
Disease
H00018  Gastric cancer
H00055  Laryngeal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    898 (CCNE1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    898 (CCNE1)
   04114 Oocyte meiosis
    898 (CCNE1)
   04115 p53 signaling pathway
    898 (CCNE1)
   04218 Cellular senescence
    898 (CCNE1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    898 (CCNE1)
   05206 MicroRNAs in cancer
    898 (CCNE1)
   05203 Viral carcinogenesis
    898 (CCNE1)
   05226 Gastric cancer
    898 (CCNE1)
   05215 Prostate cancer
    898 (CCNE1)
   05222 Small cell lung cancer
    898 (CCNE1)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    898 (CCNE1)
  Infectious diseases
   05162 Measles
    898 (CCNE1)
   05161 Hepatitis B
    898 (CCNE1)
   05165 Human papillomavirus infection
    898 (CCNE1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    898 (CCNE1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    898 (CCNE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 898
NCBI-ProteinID: NP_001229
OMIM: 123837
HGNC: 1589
Ensembl: ENSG00000105173
Vega: OTTHUMG00000177626
Pharos: P24864(Tchem)
UniProt: P24864
Structure
PDB: 

Jmol
Position
19q12
AA seq 410 aa AA seqDB search
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQ
PWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM
LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR
LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA
ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI
QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgccgagggagcgcagggagcgggatgcgaaggagcgggacaccatgaaggaggacggc
ggcgcggagttctcggctcgctccaggaagaggaaggcaaacgtgaccgtttttttgcag
gatccagatgaagaaatggccaaaatcgacaggacggcgagggaccagtgtgggagccag
ccttgggacaataatgcagtctgtgcagacccctgctccctgatccccacacctgacaaa
gaagatgatgaccgggtttacccaaactcaacgtgcaagcctcggattattgcaccatcc
agaggctccccgctgcctgtactgagctgggcaaatagagaggaagtctggaaaatcatg
ttaaacaaggaaaagacatacttaagggatcagcactttcttgagcaacaccctcttctg
cagccaaaaatgcgagcaattcttctggattggttaatggaggtgtgtgaagtctataaa
cttcacagggagaccttttacttggcacaagatttctttgaccggtatatggcgacacaa
gaaaatgttgtaaaaactcttttacagcttattgggatttcatctttatttattgcagcc
aaacttgaggaaatctatcctccaaagttgcaccagtttgcgtatgtgacagatggagct
tgttcaggagatgaaattctcaccatggaattaatgattatgaaggcccttaagtggcgt
ttaagtcccctgactattgtgtcctggctgaatgtatacatgcaggttgcatatctaaat
gacttacatgaagtgctactgccgcagtatccccagcaaatctttatacagattgcagag
ctgttggatctctgtgtcctggatgttgactgccttgaatttccttatggtatacttgct
gcttcggccttgtatcatttctcgtcatctgaattgatgcaaaaggtttcagggtatcag
tggtgcgacatagagaactgtgtcaagtggatggttccatttgccatggttataagggag
acggggagctcaaaactgaagcacttcaggggcgtcgctgatgaagatgcacacaacata
cagacccacagagacagcttggatttgctggacaaagcccgagcaaagaaagccatgttg
tctgaacaaaatagggcttctcctctccccagtgggctcctcaccccgccacagagcggt
aagaagcagagcagcgggccggaaatggcgtga

DBGET integrated database retrieval system