KEGG   Homo sapiens (human): 89869Help
Entry
89869             CDS       T01001                                 

Gene name
PLCZ1, NYD-SP27, PLC-zeta-1, PLCzeta
Definition
phospholipase C, zeta 1 (EC:3.1.4.11)
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:hsa00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:hsa04070]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p12.3
AA seq 608 aa AA seqDB search
MEMRWFLSKIQDDFRGGKINLEKTQRLLEKLDIRCSYIHVKQIFKDNDRLKQGRITIEEF
RAIYRIITHREEIIEIFNTYSENRKILLASNLAQFLTQEQYAAEMSKAIAFEIIQKYEPI
EEVRKAHQMSLEGFTRYMDSRECLLFKNECRKVYQDMTHPLNDYFISSSHNTYLVSDQLL
GPSDLWGYVSALVKGCRCLEIDCWDGAQNEPVVYHGYTLTSKLLFKTVIQAIHKYAFMTS
DYPVVLSLENHCSTAQQEVMADNLQATFGESLLSDMLDDFPDTLPSPEALKFKILVKNKK
IGTLKETHERKGSDKRGDNQDKETGVKKLPGVMLFKKKKTRKLKIALALSDLVIYTKAEK
FKSFQHSRLYQQFNENNSIGETQARKLSKLRVHEFIFHTRKFITRIYPKATRADSSNFNP
QEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPHFLRESKSYFNPSNIKEGM
PITLTIRLISGIQLPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETF
TFIIHVPELALIRFVVEGQGLIAGNEFLGQYTLPLLCMNKGYRRIPLFSRMGESLEPASL
FVYVWYVR
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgagatggtttttgtcaaagattcaggatgacttcagaggtggaaaaattaac
ctagaaaaaactcagaggttacttgaaaaattagatattcggtgcagttatattcatgtg
aaacagatttttaaggacaatgacaggctgaaacaaggaagaatcaccatagaagaattt
agagcaatttatcgaattatcacgcacagagaagaaattattgagattttcaacacatat
tctgaaaaccggaaaattcttttagcaagtaatctggctcaatttctgacacaagaacaa
tatgcagctgagatgagtaaagctattgcttttgagatcattcagaaatacgagcctatc
gaagaagttaggaaagcacaccaaatgtcattagaaggttttacaagatacatggattca
cgtgaatgtctactgtttaaaaatgaatgtagaaaagtttatcaagatatgactcatcca
ttaaatgattattttatttcatcttcacataacacatatttggtatctgatcaattattg
ggaccaagtgacctttggggatatgtaagtgcccttgtgaaaggatgccgttgtttggag
attgactgctgggatggagcacaaaatgaacctgttgtatatcatggctacacactcaca
agcaaacttctgtttaaaactgttatccaagctatacacaagtatgcattcatgacatct
gactacccagtggtgctctctttagaaaatcactgctccactgcccaacaagaagtaatg
gcagacaatttgcaggctacttttggagagtccttgctttctgatatgcttgatgatttt
cctgatactctaccatcaccagaggcactaaaattcaaaatattagttaaaaataagaaa
ataggaaccttaaaggaaacccatgaaagaaaaggttctgataagcgtggagacaatcaa
gacaaggaaacaggggtaaaaaagttacctggagtaatgcttttcaagaaaaagaagacc
aggaagctaaaaattgctctggccttatctgatcttgtcatttatacgaaagctgagaaa
ttcaaaagctttcaacattcaagattatatcagcaatttaatgaaaataattctattggg
gagacacaagcccgaaaactttcaaaattgcgagtccatgagtttatttttcacaccagg
aagttcattaccagaatatatcccaaagcaacaagagcagactcttctaattttaatccc
caagaattttggaatataggttgtcaaatggtggctttaaatttccagacccctggtctg
cccatggatctgcaaaatgggaaatttttggataatggtggttctggatatattttgaaa
ccacatttcttaagagagagtaaatcatactttaacccaagtaacataaaagagggtatg
ccaattacacttacaataaggctcatcagtggtatccagttgcctcttactcattcatca
tctaacaaaggtgattcattagtaattatagaagtttttggtgttccaaatgatcaaatg
aagcagcagactcgtgtaattaaaaaaaatgcttttagtccaagatggaatgaaacattc
acatttattattcatgtcccagaattggcattgatacgttttgttgttgaaggtcaaggt
ttaatagcaggaaatgaatttcttgggcaatatactttgccacttctatgcatgaacaaa
ggttatcgtcgtattcctctgttttccagaatgggtgagagccttgagcctgcttcactg
tttgtttatgtttggtacgtcagataa

DBGET integrated database retrieval system