KEGG   Homo sapiens (human): 902Help
Entry
902               CDS       T01001                                 

Gene name
CCNH, CAK, CycH, p34, p37
Definition
(RefSeq) cyclin H
  KO
K06634  cyclin H
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
hsa04110  Cell cycle
Module
hsa_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    902 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    902 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    902 (CCNH)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     902 (CCNH)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     902 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N Cyclin_C 5_3_exonuc_N
Motif
Other DBs
NCBI-GeneID: 902
NCBI-ProteinID: NP_001230
OMIM: 601953
HGNC: 1594
Ensembl: ENSG00000134480
Vega: OTTHUMG00000119077
Pharos: P51946(Tbio)
UniProt: P51946
Structure
PDB: 

Jmol
Position
5q14.3
AA seq 323 aa AA seqDB search
MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPI
LENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDD
DYVSKKSKHEEEEWTDDDLVESL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagtagtcagaagcggcactggaccttctccagcgaggagcagctggca
agactgcgggctgacgccaaccgcaaattcagatgcaaagccgtggccaacgggaaggtt
cttccgaatgatccagtctttcttgagcctcatgaagaaatgacactctgcaaatactat
gagaaaaggttattggaattctgttcggtgtttaagccagcaatgccaagatctgttgtg
ggtacggcttgtatgtatttcaaacgtttttatcttaataactcagtaatggaatatcac
cccaggataataatgctcacttgtgcatttttggcctgcaaagtagatgaattcaatgta
tctagtcctcagtttgttggaaacctccgggagagtcctcttggacaggagaaggcactt
gaacagatactggaatatgaactacttcttatacagcaacttaatttccaccttattgtc
cacaatccttacagaccatttgagggcttcctcatcgacttaaagacccgctatcccata
ttggagaatccagagattttgaggaaaacagctgatgactttcttaatagaattgcattg
acggatgcttaccttttatacacaccttcccaaattgccctgactgccattttatctagt
gcctccagggctggaattactatggaaagttatttatcagagagtctgatgctgaaagag
aacagaacttgcctgtcacagttactagatataatgaaaagcatgagaaacttagtaaag
aagtatgaaccacccagatctgaagaagttgctgttctgaaacagaagttggagcgatgt
cattctgctgagcttgcacttaacgtaatcacgaagaagaggaaaggctatgaagatgat
gattacgtctcaaagaaatccaaacatgaggaggaagaatggactgatgacgacctggta
gaatctctctaa

DBGET integrated database retrieval system