KEGG   Homo sapiens (human): 9020Help
Entry
9020              CDS       T01001                                 

Gene name
MAP3K14, FTDCR1B, HS, HSNIK, NIK
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14 (EC:2.7.11.25)
  KO
K04466  
mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Apoptosis
Osteoclast differentiation
T cell receptor signaling pathway
TNF signaling pathway
Intestinal immune network for IgA production
Epithelial cell signaling in Helicobacter pylori infection
HTLV-I infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    9020 (MAP3K14)
   04064 NF-kappa B signaling pathway
    9020 (MAP3K14)
   04668 TNF signaling pathway
    9020 (MAP3K14)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    9020 (MAP3K14)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    9020 (MAP3K14)
   04672 Intestinal immune network for IgA production
    9020 (MAP3K14)
  Development
   04380 Osteoclast differentiation
    9020 (MAP3K14)
 Human Diseases
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    9020 (MAP3K14)
   05166 HTLV-I infection
    9020 (MAP3K14)
   05169 Epstein-Barr virus infection
    9020 (MAP3K14)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     9020 (MAP3K14)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  Other families
   9020 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21
AA seq 947 aa AA seqDB search
MAVMEMACPGAPGSAVGQQKELPKAKEKTPPLGKKQSSVYKLEAVEKSPVFCGKWEILND
VITKGTAKEGSEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
VAHATEGKMARVCWKGKRRSKARKKRKKKSSKSLAHAGVALAKPLPRTPEQESCTIPVQE
DESPLGAPYVRNTPQFTKPLKEPGLGQLCFKQLGEGLRPALPRSELHKLISPLQCLNHVW
KLHHPQDGGPLPLPTHPFPYSRLPHPFPFHPLQPWKPHPLESFLGKLACVDSQKPLPDPH
LSKLACVDSPKPLPGPHLEPSCLSRGAHEKFSVEEYLVHALQGSVSSGQAHSLTSLAKTW
AARGSRSREPSPKTEDNEGVLLTEKLKPVDYEYREEVHWATHQLRLGRGSFGEVHRMEDK
QTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQL
VKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVC
LQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFF
RGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRALQQVGG
LKSPWRGEYKEPRHPPPNQANYHQTLHAQPRELSPRAPGPRPAEETTGRAPKLQPPLPPE
PPEPNKSPPLTLSKEESGMWEPLPLSSLEPAPARNPSSPERKATVPEQELQQLEIELFLN
SLSQPFSLEEQEQILSCLSIDSLSLSDDSEKNPSKASQSSRDTLSSGVHSWSSQAEARSS
SWNMVLARGRPTDTPSYFNGVKVQIQSLNGEHLHIREFHRVKVGDIATGISSQIPAAAFS
LVTKDGQPVRYDMEVPDSGIDLQCTLAPDGSFAWSWRVKHGQLENRP
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggaaatggcctgcccaggtgcccctggctcagcagtggggcagcagaag
gaactccccaaagccaaggagaagacgccgccactggggaagaaacagagctccgtctac
aagcttgaggccgtggagaagagccctgtgttctgcggaaagtgggagatcctgaatgac
gtgattaccaagggcacagccaaggaaggctccgaggcagggccagctgccatctctatc
atcgcccaggctgagtgtgagaatagccaagagttcagccccaccttttcagaacgcatt
ttcatcgctgggtccaaacagtacagccagtccgagagtcttgatcagatccccaacaat
gtggcccatgctacagagggcaaaatggcccgtgtgtgttggaagggaaagcgtcgcagc
aaagcccggaagaaacggaagaagaagagctcaaagtccctggctcatgcaggagtggcc
ttggccaaacccctccccaggacccctgagcaggagagctgcaccatcccagtgcaggag
gatgagtctccactcggcgccccatatgttagaaacaccccgcagttcaccaagcctctg
aaggaaccaggccttgggcaactctgttttaagcagcttggcgagggcctacggccggct
ctgcctcgatcagaactccacaaactgatcagccccttgcaatgtctgaaccacgtgtgg
aaactgcaccacccccaggacggaggccccctgcccctgcccacgcaccccttcccctat
agcagactgcctcatcccttcccattccaccctctccagccctggaaacctcaccctctg
gagtccttcctgggcaaactggcctgtgtagacagccagaaacccttgcctgacccacac
ctgagcaaactggcctgtgtagacagtccaaagcccctgcctggcccacacctggagccc
agctgcctgtctcgtggtgcccatgagaagttttctgtggaggaatacctagtgcatgct
ctgcaaggcagcgtgagctcaggccaggcccacagcctgaccagcctggccaagacctgg
gcagcaaggggctccagatcccgggagcccagccccaaaactgaggacaacgagggtgtc
ctgctcactgagaaactcaagccagtggattatgagtaccgagaagaagtccactgggcc
acgcaccagctccgcctgggcagaggctccttcggagaggtgcacaggatggaggacaag
cagactggcttccagtgcgctgtcaaaaaggtgcggctggaagtatttcgggcagaggag
ctgatggcatgtgcaggattgacctcacccagaattgtccctttgtatggagctgtgaga
gaagggccttgggtcaacatcttcatggagctgctggaaggtggctccctgggccagctg
gtcaaggagcagggctgtctcccagaggaccgggccctgtactacctgggccaggccctg
gagggtctggaatacctccactcacgaaggattctgcatggggacgtcaaagctgacaac
gtgctcctgtccagcgatgggagccacgcagccctctgtgactttggccatgctgtgtgt
cttcaacctgatggcctgggaaagtccttgctcacaggggactacatccctggcacagag
acccacatggctccggaggtggtgctgggcaggagctgcgacgccaaggtggatgtctgg
agcagctgctgtatgatgctgcacatgctcaacggctgccacccctggactcagttcttc
cgagggccgctctgcctcaagattgccagcgagcctccgcctgtgagggagatcccaccc
tcctgcgcccctctcacagcccaggccatccaagaggggctgaggaaagagcccatccac
cgcgtgtctgcagcggagctgggagggaaggtgaaccgggcactacagcaagtgggaggt
ctgaagagcccttggaggggagaatataaagaaccaagacatccaccgccaaatcaagcc
aattaccaccagaccctccatgcccagccgagagagctttcgccaagggccccagggccc
cggccagctgaggagacaacaggcagagcccctaagctccagcctcctctcccaccagag
cccccagagccaaacaagtctcctcccttgactttgagcaaggaggagtctgggatgtgg
gaacccttacctctgtcctccctggagccagcccctgccagaaaccccagctcaccagag
cggaaagcaaccgtcccggagcaggaactgcagcagctggaaatagaattattcctcaac
agcctgtcccagccattttctctggaggagcaggagcaaattctctcgtgcctcagcatc
gacagcctctccctgtcggatgacagtgagaagaacccatcaaaggcctctcaaagctcg
cgggacaccctgagctcaggcgtacactcctggagcagccaggccgaggctcgaagctcc
agctggaacatggtgctggcccgggggcggcccaccgacaccccaagctatttcaatggt
gtgaaagtccaaatacagtctcttaatggtgaacacctgcacatccgggagttccaccgg
gtcaaagtgggagacatcgccactggcatcagcagccagatcccagctgcagccttcagc
ttggtcaccaaagacgggcagcctgttcgctacgacatggaggtgccagactcgggcatc
gacctgcagtgcacactggcccctgatggcagcttcgcctggagctggagggtcaagcat
ggccagctggagaacaggccctaa

DBGET integrated database retrieval system