KEGG   Homo sapiens (human): 9033Help
Entry
9033              CDS       T01001                                 

Gene name
PKD2L1, PCL, PKD2L, PKDL, TRPP3
Definition
(RefSeq) polycystin 2 like 1, transient receptor potential cation channel
  KO
K04990  
polycystin 2L1
Organism
hsa  Homo sapiens (human)
Pathway
Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04742 Taste transduction
    9033 (PKD2L1)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPP (Polycystin)
   9033 (PKD2L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q24
AA seq 805 aa AA seqDB search
MNAVGSPEGQELQKLGSGAWDNPAYSGPPSPHGTLRVCTISSTGPLQPQPKKPEDEPQET
AYRTQVSSCCLHICQGIRGLWGTTLTENTAENRELYIKTTLRELLVYIVFLVDICLLTYG
MTSSSAYYYTKVMSELFLHTPSDTGVSFQAISSMADFWDFAQGPLLDSLYWTKWYNNQSL
GHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPF
NGTAWTYHSQDELGGFSHWGRLTSYSGGGYYLDLPGSRQGSAEALRALQEGLWLDRGTRV
VFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSNWDFFIVGCEVIFC
VFIFYYVVEEILELHIHRLRYLSSIWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQ
QPNTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGF
AVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAY
FVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKE
RVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQEK
MRQDLEEERVALNTEIEKLGRSIVSSPQGKSGPEAARAGGWVSGEEFYMLTRRVLQLETV
LEGVVSQIDAVGSKLKMLERKGWLAPSPGVKEQAIWKHPQPAPAVTPDPWGVQGGQESEV
PYKREEEALEERRLSRGEIPTLQRS
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgtgggaagtcctgaggggcaggagctgcaaaagctggggagtggagcctgg
gacaaccccgcctacagtggtcccccttccccacacgggacgctgagagtctgcaccatc
tccagcacggggcctctccagccccaacccaagaagcctgaagatgaaccccaggagacg
gcatacaggacccaggtgtccagctgctgcctccatatctgtcaaggcatcagaggactt
tggggaacaaccctgactgagaacacagctgagaaccgggaactttatatcaagaccacc
ctgagggagctgttggtatatattgtgttcctggtggacatctgtctactgacctatgga
atgacaagctccagtgcttattactacaccaaagtgatgtctgagctcttcttacatact
ccatcagacactggagtctcctttcaggccatcagcagcatggcggacttctgggatttt
gcccagggcccactactggacagtttgtattggaccaaatggtacaacaaccagagcctg
ggccatggctcccactccttcatctactatgagaacatgctgctgggggttccgaggctg
cggcagctaaaggtccgcaatgactcctgtgtggtgcatgaagacttccgggaggacatt
ctgagctgctatgatgtctactctccagacaaagaagaacaactcccctttgggcccttc
aatggcacagcgtggacataccactcgcaggatgagttggggggcttctcccactggggc
aggctcacaagctacagcggaggtggctactacctggaccttccaggatcccgacagggt
agtgcagaggctctccgggcccttcaggaggggctgtggctggacaggggcactcgagtg
gtgttcatcgacttctcagtctacaatgccaatatcaatcttttctgtgtcctgaggctg
gtggtggagtttccagctacaggaggtgccatcccatcctggcaaatccgcacagtcaag
ctgatccgctatgtcagcaactgggacttctttatcgttggctgtgaggtcatcttctgc
gtcttcatcttctactatgtggtggaagagatcctggagctccacattcaccggcttcgc
tacctcagcagcatctggaacatactggacctggtggtcatcttgctctccattgtggct
gtgggcttccacatattccgaaccctcgaggtgaatcggctcatggggaagctcctgcag
cagccaaacacgtatgcagactttgagttcctcgccttctggcagacacagtacaacaac
atgaatgctgtcaacctcttcttcgcctggatcaagatattcaagtacatcagcttcaac
aaaaccatgacccagctctcctccacgctggcccgctgtgccaaggacatcctgggcttc
gccgtcatgttcttcattgttttcttcgcctatgcccaactcggctacctgcttttcggg
acccaagtggaaaactttagcactttcatcaagtgcattttcactcagttccggataatc
ctcggggactttgactacaatgctatcgacaatgccaaccgcatcctgggccctgcctac
tttgtcacctatgtcttcttcgtcttcttcgtgctcctgaacatgttcctggccatcatc
aatgacacatattcagaggtcaaggaggagctggctggacagaaggatgagctgcaactt
tctgacctcctgaaacagggctacaacaagaccctactaagactgcgtctgaggaaggag
agggtttcggatgtgcagaaggtcctgcagggtggggagcaggagatccagtttgaggat
ttcaccaacaccttaagggaactgggacacgcagagcatgaaatcactgagctcacggcc
accttcaccaagtttgacagagatgggaatcgtattctggatgagaaggaacaggaaaaa
atgcgacaggacctggaggaagagagggtggccctcaacactgagattgagaaactaggc
cgatctattgtgagcagcccacaaggcaaatcgggtccagaggctgccagagcaggaggc
tgggtttcaggagaagaattctacatgctcacaaggagagttctgcagctggagactgtc
ctggaaggagtagtgtcccagattgatgctgtaggctcaaagctgaaaatgctggagagg
aaggggtggctggctccctccccaggcgtgaaggaacaagctatttggaagcacccgcag
ccagccccagctgtgaccccagacccctggggagtccagggtgggcaggagagtgaggtt
ccctataaaagagaagaggaagccttagaggagaggagactctcccgtggtgagattcca
acgttgcagaggagttaa

DBGET integrated database retrieval system