KEGG   Homo sapiens (human): 9071Help
Entry
9071              CDS       T01001                                 

Gene name
CLDN10, CPETRL3, OSP-L
Definition
(RefSeq) claudin 10
  KO
K06087  
claudin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    9071 (CLDN10)
 Cellular Processes
  Cellular community
   04530 Tight junction
    9071 (CLDN10)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    9071 (CLDN10)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    9071 (CLDN10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   9071 (CLDN10)
  Exosomal proteins of colorectal cancer cells
   9071 (CLDN10)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  CLDN; claudin [KO:K06087]
   9071 (CLDN10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q31-q34
AA seq 228 aa AA seqDB search
MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGV
SNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLA
GIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFC
FSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggctagcacggcttcggagatcatcgccttcatggtctccatctcaggctgggtactg
gtgtcctccacgctgcccaccgactactggaaggtgtctaccatcgacggcacggtcatc
acaaccgccacctattgggccaacctgtggaaggcgtgcgttaccgactccacgggcgtc
tccaactgcaaggacttcccctccatgctggcgctggacggttatatacaggcatgtaga
ggacttatgatcgctgctgtcagcctgggcttctttggttccatatttgcgctctttgga
atgaagtgtaccaaagtcggaggctccgataaagccaaagctaaaattgcttgtttggct
gggattgtattcatactgtcagggctgtgctcaatgactggatgttccctatatgcaaac
aaaatcacaacggaattctttgatcctctctttgttgagcaaaagtatgaattaggagcc
gctctgtttattggatgggcaggagcctcactgtgcataattggtggtgtcatattttgc
ttttcaatatctgacaacaacaaaacacccagatacacatacaacggggccacatctgtc
atgtcttctcggacaaagtatcatggtggagaagattttaaaacaacaaacccttcaaaa
cagtttgataaaaatgcttatgtctaa

DBGET integrated database retrieval system