KEGG   Homo sapiens (human): 9071Help
Entry
9071              CDS       T01001                                 

Gene name
CLDN10, CPETRL3, OSP-L
Definition
claudin 10
Orthology
K06087  
claudin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    9071 (CLDN10)
 Cellular Processes
  Cell communication
   04530 Tight junction
    9071 (CLDN10)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    9071 (CLDN10)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    9071 (CLDN10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   9071 (CLDN10)
  Exosomal proteins of colorectal cancer cells
   9071 (CLDN10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q31-q34
AA seq 207 aa AA seqDB search
MSRAQIWALVSGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCAGYIQACRG
LMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANK
ITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVM
SSRTKYHGGEDFKTTNPSKQFDKNAYV
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtccagggcgcagatctgggctctggtgtctggtgtcggagggtttggagctctcgtt
gctgctaccacgtccaatgagtggaaagtgaccacgcgagcctcctcggtgataacagcc
acttgggtttaccagggtctgtggatgaactgcgcaggttatatacaggcatgtagagga
cttatgatcgctgctgtcagcctgggcttctttggttccatatttgcgctctttggaatg
aagtgtaccaaagtcggaggctccgataaagccaaagctaaaattgcttgtttggctggg
attgtattcatactgtcagggctgtgctcaatgactggatgttccctatatgcaaacaaa
atcacaacggaattctttgatcctctctttgttgagcaaaagtatgaattaggagccgct
ctgtttattggatgggcaggagcctcactgtgcataattggtggtgtcatattttgcttt
tcaatatctgacaacaacaaaacacccagatacacatacaacggggccacatctgtcatg
tcttctcggacaaagtatcatggtggagaagattttaaaacaacaaacccttcaaaacag
tttgataaaaatgcttatgtctaa

DBGET integrated database retrieval system